Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4197090..4197640 Replicon chromosome
Accession NZ_CP117346
Organism Salmonella enterica subsp. enterica serovar Dublin strain RM104

Toxin (Protein)


Gene name ccdB Uniprot ID M7RJ32
Locus tag PQP85_RS20685 Protein ID WP_001199743.1
Coordinates 4197090..4197398 (-) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID M7RP97
Locus tag PQP85_RS20690 Protein ID WP_001118105.1
Coordinates 4197401..4197640 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP85_RS20665 (4193664) 4193664..4194404 - 741 WP_001575372.1 SEF14/SEF18 fimbria chaperone SefB -
PQP85_RS20670 (4194526) 4194526..4195056 - 531 WP_000909460.1 SEF14 fimbria major subunit SefA -
PQP85_RS20675 (4195379) 4195379..4196512 + 1134 Protein_4047 IS3 family transposase -
PQP85_RS20680 (4196544) 4196544..4196684 - 141 Protein_4048 Arm DNA-binding domain-containing protein -
PQP85_RS20685 (4197090) 4197090..4197398 - 309 WP_001199743.1 CcdB family protein Toxin
PQP85_RS20690 (4197401) 4197401..4197640 - 240 WP_001118105.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
PQP85_RS20695 (4197749) 4197749..4197997 - 249 WP_000168389.1 ribbon-helix-helix domain-containing protein -
PQP85_RS20700 (4198188) 4198188..4198619 - 432 Protein_4052 helix-turn-helix domain-containing protein -
PQP85_RS20710 (4199376) 4199376..4200395 + 1020 WP_000152558.1 NAD(P)-dependent alcohol dehydrogenase -
PQP85_RS20715 (4200423) 4200423..4200953 - 531 WP_000896758.1 gluconokinase -
PQP85_RS20720 (4201170) 4201170..4202201 + 1032 WP_000453348.1 L-idonate 5-dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside IScluster/Tn - - 4195471..4198574 3103
- inside Genomic island - - 4178358..4197997 19639


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(9-79)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11845.67 Da        Isoelectric Point: 6.7228

>T270686 WP_001199743.1 NZ_CP117346:c4197398-4197090 [Salmonella enterica subsp. enterica serovar Dublin]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF

Download         Length: 309 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8719.90 Da        Isoelectric Point: 6.4633

>AT270686 WP_001118105.1 NZ_CP117346:c4197640-4197401 [Salmonella enterica subsp. enterica serovar Dublin]
MPGMSVRHKKTVSVTLEPALLQQARDAGINLSAVLTAALKEEISATGVERWKAENRAGLQELNRITDEHGLLSDDYRTF

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C6Z9V9

Antitoxin

Source ID Structure
AlphaFold DB A0A5H9SZK8

References