Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 309894..310480 Replicon chromosome
Accession NZ_CP117346
Organism Salmonella enterica subsp. enterica serovar Dublin strain RM104

Toxin (Protein)


Gene name doc Uniprot ID M7S4C0
Locus tag PQP85_RS01420 Protein ID WP_001575091.1
Coordinates 310112..310480 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag PQP85_RS01415 Protein ID WP_001520924.1
Coordinates 309894..310115 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP85_RS01390 (304915) 304915..306024 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
PQP85_RS01395 (306084) 306084..307010 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
PQP85_RS01400 (307007) 307007..308284 + 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
PQP85_RS01405 (308281) 308281..309048 + 768 WP_001751764.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
PQP85_RS01410 (309050) 309050..309763 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
PQP85_RS01415 (309894) 309894..310115 + 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PQP85_RS01420 (310112) 310112..310480 + 369 WP_001575091.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PQP85_RS01425 (310739) 310739..312055 + 1317 WP_000624752.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
PQP85_RS01430 (312160) 312160..313047 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
PQP85_RS01435 (313044) 313044..313889 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
PQP85_RS01440 (313891) 313891..314961 + 1071 WP_000907846.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 307007..315698 8691
- inside Prophage - - 302817..315698 12881


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(24-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13701.98 Da        Isoelectric Point: 5.6993

>T270673 WP_001575091.1 NZ_CP117346:310112-310480 [Salmonella enterica subsp. enterica serovar Dublin]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPERAEALMYRVLNQIEYEGVTDVWLLAAMHLLTISRGYIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT270673 WP_001520924.1 NZ_CP117346:309894-310115 [Salmonella enterica subsp. enterica serovar Dublin]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB M7S4C0

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References