Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-DnaT |
| Location | 40839..41361 | Replicon | plasmid pRM105_2 |
| Accession | NZ_CP117345 | ||
| Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM105 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | G3CAN5 |
| Locus tag | PQP76_RS24535 | Protein ID | WP_000220560.1 |
| Coordinates | 41080..41361 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | G3CAG1 |
| Locus tag | PQP76_RS24530 | Protein ID | WP_000121743.1 |
| Coordinates | 40839..41090 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP76_RS24505 (PQP76_24505) | 36250..36870 | + | 621 | WP_000864788.1 | ParA family protein | - |
| PQP76_RS24510 (PQP76_24510) | 36922..37152 | + | 231 | WP_000051066.1 | plasmid partition protein ParG | - |
| PQP76_RS24515 (PQP76_24515) | 37791..38144 | - | 354 | WP_001675596.1 | DNA distortion polypeptide 3 | - |
| PQP76_RS24520 (PQP76_24520) | 38281..38727 | - | 447 | WP_001074381.1 | hypothetical protein | - |
| PQP76_RS24525 (PQP76_24525) | 38767..39603 | - | 837 | WP_001575533.1 | replication initiation protein | - |
| PQP76_RS24530 (PQP76_24530) | 40839..41090 | + | 252 | WP_000121743.1 | plasmid stabilization protein | Antitoxin |
| PQP76_RS24535 (PQP76_24535) | 41080..41361 | + | 282 | WP_000220560.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PQP76_RS24540 (PQP76_24540) | 41507..41830 | + | 324 | WP_001181909.1 | hypothetical protein | - |
| PQP76_RS24545 (PQP76_24545) | 41875..42120 | + | 246 | WP_000356542.1 | hypothetical protein | - |
| PQP76_RS24550 (PQP76_24550) | 42110..42325 | + | 216 | WP_001180117.1 | hypothetical protein | - |
| PQP76_RS24555 (PQP76_24555) | 42418..42747 | + | 330 | WP_000866650.1 | hypothetical protein | - |
| PQP76_RS24560 (PQP76_24560) | 42790..42969 | + | 180 | WP_001575529.1 | hypothetical protein | - |
| PQP76_RS24565 (PQP76_24565) | 42991..43188 | + | 198 | WP_001675595.1 | hypothetical protein | - |
| PQP76_RS24570 (PQP76_24570) | 43201..43473 | + | 273 | WP_000160399.1 | hypothetical protein | - |
| PQP76_RS24575 (PQP76_24575) | 43799..44344 | + | 546 | WP_000757691.1 | DNA distortion polypeptide 1 | - |
| PQP76_RS24580 (PQP76_24580) | 44347..45528 | + | 1182 | WP_000539536.1 | MobP1 family relaxase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | faeH / faeI / spvC / spvB | 1..74562 | 74562 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11005.83 Da Isoelectric Point: 10.5938
>T270671 WP_000220560.1 NZ_CP117345:41080-41361 [Salmonella enterica subsp. enterica serovar Dublin]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G3CAN5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3S5I301 |