Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 40839..41361 Replicon plasmid pRM105_2
Accession NZ_CP117345
Organism Salmonella enterica subsp. enterica serovar Dublin strain RM105

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag PQP76_RS24535 Protein ID WP_000220560.1
Coordinates 41080..41361 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag PQP76_RS24530 Protein ID WP_000121743.1
Coordinates 40839..41090 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP76_RS24505 (PQP76_24505) 36250..36870 + 621 WP_000864788.1 ParA family protein -
PQP76_RS24510 (PQP76_24510) 36922..37152 + 231 WP_000051066.1 plasmid partition protein ParG -
PQP76_RS24515 (PQP76_24515) 37791..38144 - 354 WP_001675596.1 DNA distortion polypeptide 3 -
PQP76_RS24520 (PQP76_24520) 38281..38727 - 447 WP_001074381.1 hypothetical protein -
PQP76_RS24525 (PQP76_24525) 38767..39603 - 837 WP_001575533.1 replication initiation protein -
PQP76_RS24530 (PQP76_24530) 40839..41090 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
PQP76_RS24535 (PQP76_24535) 41080..41361 + 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PQP76_RS24540 (PQP76_24540) 41507..41830 + 324 WP_001181909.1 hypothetical protein -
PQP76_RS24545 (PQP76_24545) 41875..42120 + 246 WP_000356542.1 hypothetical protein -
PQP76_RS24550 (PQP76_24550) 42110..42325 + 216 WP_001180117.1 hypothetical protein -
PQP76_RS24555 (PQP76_24555) 42418..42747 + 330 WP_000866650.1 hypothetical protein -
PQP76_RS24560 (PQP76_24560) 42790..42969 + 180 WP_001575529.1 hypothetical protein -
PQP76_RS24565 (PQP76_24565) 42991..43188 + 198 WP_001675595.1 hypothetical protein -
PQP76_RS24570 (PQP76_24570) 43201..43473 + 273 WP_000160399.1 hypothetical protein -
PQP76_RS24575 (PQP76_24575) 43799..44344 + 546 WP_000757691.1 DNA distortion polypeptide 1 -
PQP76_RS24580 (PQP76_24580) 44347..45528 + 1182 WP_000539536.1 MobP1 family relaxase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - faeH / faeI / spvC / spvB 1..74562 74562


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T270671 WP_000220560.1 NZ_CP117345:41080-41361 [Salmonella enterica subsp. enterica serovar Dublin]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT270671 WP_000121743.1 NZ_CP117345:40839-41090 [Salmonella enterica subsp. enterica serovar Dublin]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References