Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 11801..12456 Replicon plasmid pRM105_2
Accession NZ_CP117345
Organism Salmonella enterica subsp. enterica serovar Dublin strain RM105

Toxin (Protein)


Gene name vagD Uniprot ID M7RF18
Locus tag PQP76_RS24345 Protein ID WP_000812999.1
Coordinates 11801..12229 (-) Length 143 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID H9AC95
Locus tag PQP76_RS24350 Protein ID WP_001261283.1
Coordinates 12226..12456 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP76_RS24310 (PQP76_24310) 7202..7966 + 765 WP_000827659.1 K88 minor fimbrial subunit faeI -
PQP76_RS24315 (PQP76_24315) 7953..8228 + 276 WP_001020576.1 hypothetical protein -
PQP76_RS24320 (PQP76_24320) 8228..8941 + 714 WP_000801115.1 hypothetical protein -
PQP76_RS24325 (PQP76_24325) 9066..9650 + 585 WP_001575501.1 hypothetical protein -
PQP76_RS24330 (PQP76_24330) 9723..9935 + 213 WP_000063794.1 FaeA/PapI family transcriptional regulator -
PQP76_RS24335 (PQP76_24335) 10196..10357 + 162 WP_001816720.1 hypothetical protein -
PQP76_RS24340 (PQP76_24340) 10383..11231 + 849 WP_000175391.1 SdiA-regulated domain-containing protein -
PQP76_RS24345 (PQP76_24345) 11801..12229 - 429 WP_000812999.1 type II toxin-antitoxin system VapC family toxin Toxin
PQP76_RS24350 (PQP76_24350) 12226..12456 - 231 WP_001261283.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PQP76_RS24355 (PQP76_24355) 13201..13419 + 219 WP_000813641.1 type II toxin-antitoxin system antitoxin CcdA -
PQP76_RS24360 (PQP76_24360) 13421..13726 + 306 WP_001159863.1 type II toxin-antitoxin system toxin CcdB -
PQP76_RS24365 (PQP76_24365) 13728..14018 + 291 WP_001266176.1 hypothetical protein -
PQP76_RS24370 (PQP76_24370) 14015..14536 + 522 WP_000198608.1 hypothetical protein -
PQP76_RS24375 (PQP76_24375) 14571..15353 + 783 WP_000082169.1 site-specific integrase -
PQP76_RS24380 (PQP76_24380) 15362..16045 + 684 WP_001751692.1 EAL domain-containing protein -
PQP76_RS24385 (PQP76_24385) 16099..16587 + 489 WP_001075507.1 CaiF/GrlA family transcriptional regulator -
PQP76_RS24390 (PQP76_24390) 16581..16917 + 337 Protein_24 hypothetical protein -
PQP76_RS24395 (PQP76_24395) 16908..17249 + 342 Protein_25 LysM peptidoglycan-binding domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - faeH / faeI / spvC / spvB 1..74562 74562


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(9-133)

Antitoxin

SpoVT-AbrB domain

(7-50)


Sequences

Toxin        


Download         Length: 143 a.a.        Molecular weight: 15483.03 Da        Isoelectric Point: 7.6736

>T270669 WP_000812999.1 NZ_CP117345:c12229-11801 [Salmonella enterica subsp. enterica serovar Dublin]
MKQPRTKTYMLDTCICSFIMREQSEAVLKRLEQAVLRGHRIVISAITYSEMRFGATGPKASPRLVQLVDAFCARLDAILP
WDRAAVDATTEIKVALCLAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVS

Download         Length: 429 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8737.83 Da        Isoelectric Point: 4.3775

>AT270669 WP_001261283.1 NZ_CP117345:c12456-12226 [Salmonella enterica subsp. enterica serovar Dublin]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQLEKADPDFMAEREDVVSDEGRFEL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB M7RF18

Antitoxin

Source ID Structure
AlphaFold DB A0A6X6R7C5

References