Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4236624..4237140 | Replicon | chromosome |
Accession | NZ_CP117343 | ||
Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM105 |
Toxin (Protein)
Gene name | relE | Uniprot ID | M7RIY5 |
Locus tag | PQP76_RS20870 | Protein ID | WP_000220574.1 |
Coordinates | 4236624..4236908 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | PQP76_RS20875 | Protein ID | WP_000212724.1 |
Coordinates | 4236898..4237140 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP76_RS20855 (4231740) | 4231740..4233392 | + | 1653 | WP_001751520.1 | alpha,alpha-phosphotrehalase | - |
PQP76_RS20860 (4233801) | 4233801..4235939 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
PQP76_RS20865 (4236156) | 4236156..4236620 | + | 465 | WP_001009173.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
PQP76_RS20870 (4236624) | 4236624..4236908 | - | 285 | WP_000220574.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PQP76_RS20875 (4236898) | 4236898..4237140 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PQP76_RS20880 (4237218) | 4237218..4239131 | - | 1914 | WP_001212138.1 | PRD domain-containing protein | - |
PQP76_RS20885 (4239148) | 4239148..4239888 | - | 741 | WP_000779259.1 | KDGP aldolase family protein | - |
PQP76_RS20890 (4239885) | 4239885..4241003 | - | 1119 | WP_001139169.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
PQP76_RS20895 (4240987) | 4240987..4242120 | - | 1134 | WP_000459958.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10869.68 Da Isoelectric Point: 9.8739
>T270664 WP_000220574.1 NZ_CP117343:c4236908-4236624 [Salmonella enterica subsp. enterica serovar Dublin]
MTYELEFDPRALKEWHKLGDTVKAQIKKKLADVLLDPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQIKKKLADVLLDPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | M7RIY5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |