Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4195459..4196009 Replicon chromosome
Accession NZ_CP117343
Organism Salmonella enterica subsp. enterica serovar Dublin strain RM105

Toxin (Protein)


Gene name ccdB Uniprot ID M7RJ32
Locus tag PQP76_RS20665 Protein ID WP_001199743.1
Coordinates 4195459..4195767 (-) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID M7RP97
Locus tag PQP76_RS20670 Protein ID WP_001118105.1
Coordinates 4195770..4196009 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP76_RS20645 (4192033) 4192033..4192773 - 741 WP_001575372.1 SEF14/SEF18 fimbria chaperone SefB -
PQP76_RS20650 (4192895) 4192895..4193425 - 531 WP_000909460.1 SEF14 fimbria major subunit SefA -
PQP76_RS20655 (4193748) 4193748..4194881 + 1134 Protein_4045 IS3 family transposase -
PQP76_RS20660 (4194913) 4194913..4195053 - 141 Protein_4046 Arm DNA-binding domain-containing protein -
PQP76_RS20665 (4195459) 4195459..4195767 - 309 WP_001199743.1 CcdB family protein Toxin
PQP76_RS20670 (4195770) 4195770..4196009 - 240 WP_001118105.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
PQP76_RS20675 (4196118) 4196118..4196366 - 249 WP_000168389.1 ribbon-helix-helix domain-containing protein -
PQP76_RS20680 (4196557) 4196557..4196988 - 432 Protein_4050 helix-turn-helix domain-containing protein -
PQP76_RS20690 (4197745) 4197745..4198764 + 1020 WP_274882125.1 NAD(P)-dependent alcohol dehydrogenase -
PQP76_RS20695 (4198792) 4198792..4199322 - 531 WP_000896758.1 gluconokinase -
PQP76_RS20700 (4199539) 4199539..4200570 + 1032 WP_000453348.1 L-idonate 5-dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside IScluster/Tn - - 4193840..4196943 3103


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(9-79)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11845.67 Da        Isoelectric Point: 6.7228

>T270663 WP_001199743.1 NZ_CP117343:c4195767-4195459 [Salmonella enterica subsp. enterica serovar Dublin]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF

Download         Length: 309 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8719.90 Da        Isoelectric Point: 6.4633

>AT270663 WP_001118105.1 NZ_CP117343:c4196009-4195770 [Salmonella enterica subsp. enterica serovar Dublin]
MPGMSVRHKKTVSVTLEPALLQQARDAGINLSAVLTAALKEEISATGVERWKAENRAGLQELNRITDEHGLLSDDYRTF

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C6Z9V9

Antitoxin

Source ID Structure
AlphaFold DB A0A5H9SZK8

References