Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 824280..824940 | Replicon | chromosome |
Accession | NZ_CP117343 | ||
Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM105 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | Q57K70 |
Locus tag | PQP76_RS03975 | Protein ID | WP_000244756.1 |
Coordinates | 824527..824940 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S5MU13 |
Locus tag | PQP76_RS03970 | Protein ID | WP_000351186.1 |
Coordinates | 824280..824546 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP76_RS03950 (820211) | 820211..821644 | - | 1434 | WP_001230141.1 | 6-phospho-beta-glucosidase BglA | - |
PQP76_RS03955 (821799) | 821799..822113 | + | 315 | WP_001182980.1 | N(4)-acetylcytidine aminohydrolase | - |
PQP76_RS03960 (822275) | 822275..822934 | + | 660 | WP_000250289.1 | hemolysin III family protein | - |
PQP76_RS03965 (823050) | 823050..824030 | - | 981 | WP_000874174.1 | tRNA-modifying protein YgfZ | - |
PQP76_RS03970 (824280) | 824280..824546 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
PQP76_RS03975 (824527) | 824527..824940 | + | 414 | WP_000244756.1 | protein YgfX | Toxin |
PQP76_RS03980 (824993) | 824993..825514 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
PQP76_RS03985 (825627) | 825627..826523 | + | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
PQP76_RS03990 (826547) | 826547..827260 | + | 714 | WP_000745614.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PQP76_RS03995 (827266) | 827266..828999 | + | 1734 | WP_000813387.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16183.15 Da Isoelectric Point: 10.7537
>T270652 WP_000244756.1 NZ_CP117343:824527-824940 [Salmonella enterica subsp. enterica serovar Dublin]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E9V5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0YWH4 |