Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4234420..4234936 | Replicon | chromosome |
| Accession | NZ_CP117340 | ||
| Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM111 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | M7RIY5 |
| Locus tag | PQQ02_RS20855 | Protein ID | WP_000220574.1 |
| Coordinates | 4234420..4234704 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | PQQ02_RS20860 | Protein ID | WP_000212724.1 |
| Coordinates | 4234694..4234936 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ02_RS20840 (4229536) | 4229536..4231188 | + | 1653 | WP_001751520.1 | alpha,alpha-phosphotrehalase | - |
| PQQ02_RS20845 (4231597) | 4231597..4233735 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| PQQ02_RS20850 (4233952) | 4233952..4234416 | + | 465 | WP_001009173.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| PQQ02_RS20855 (4234420) | 4234420..4234704 | - | 285 | WP_000220574.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PQQ02_RS20860 (4234694) | 4234694..4234936 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PQQ02_RS20865 (4235014) | 4235014..4236927 | - | 1914 | WP_001212138.1 | PRD domain-containing protein | - |
| PQQ02_RS20870 (4236944) | 4236944..4237684 | - | 741 | WP_000779259.1 | KDGP aldolase family protein | - |
| PQQ02_RS20875 (4237681) | 4237681..4238799 | - | 1119 | WP_001139169.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| PQQ02_RS20880 (4238783) | 4238783..4239916 | - | 1134 | WP_000459958.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10869.68 Da Isoelectric Point: 9.8739
>T270641 WP_000220574.1 NZ_CP117340:c4234704-4234420 [Salmonella enterica subsp. enterica serovar Dublin]
MTYELEFDPRALKEWHKLGDTVKAQIKKKLADVLLDPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQIKKKLADVLLDPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | M7RIY5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |