Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4193255..4193805 Replicon chromosome
Accession NZ_CP117340
Organism Salmonella enterica subsp. enterica serovar Dublin strain RM111

Toxin (Protein)


Gene name ccdB Uniprot ID M7RJ32
Locus tag PQQ02_RS20650 Protein ID WP_001199743.1
Coordinates 4193255..4193563 (-) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID M7RP97
Locus tag PQQ02_RS20655 Protein ID WP_001118105.1
Coordinates 4193566..4193805 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ02_RS20630 (4189829) 4189829..4190569 - 741 WP_001575372.1 SEF14/SEF18 fimbria chaperone SefB -
PQQ02_RS20635 (4190691) 4190691..4191221 - 531 WP_000909460.1 SEF14 fimbria major subunit SefA -
PQQ02_RS20640 (4191544) 4191544..4192677 + 1134 Protein_4040 IS3 family transposase -
PQQ02_RS20645 (4192709) 4192709..4192849 - 141 Protein_4041 Arm DNA-binding domain-containing protein -
PQQ02_RS20650 (4193255) 4193255..4193563 - 309 WP_001199743.1 CcdB family protein Toxin
PQQ02_RS20655 (4193566) 4193566..4193805 - 240 WP_001118105.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
PQQ02_RS20660 (4193914) 4193914..4194162 - 249 WP_000168389.1 ribbon-helix-helix domain-containing protein -
PQQ02_RS20665 (4194353) 4194353..4194784 - 432 Protein_4045 helix-turn-helix domain-containing protein -
PQQ02_RS20675 (4195541) 4195541..4196560 + 1020 WP_274891549.1 NAD(P)-dependent alcohol dehydrogenase -
PQQ02_RS20680 (4196588) 4196588..4197118 - 531 WP_000896758.1 gluconokinase -
PQQ02_RS20685 (4197335) 4197335..4198366 + 1032 WP_000453348.1 L-idonate 5-dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside IScluster/Tn - - 4191636..4194739 3103


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(9-79)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11845.67 Da        Isoelectric Point: 6.7228

>T270640 WP_001199743.1 NZ_CP117340:c4193563-4193255 [Salmonella enterica subsp. enterica serovar Dublin]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF

Download         Length: 309 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8719.90 Da        Isoelectric Point: 6.4633

>AT270640 WP_001118105.1 NZ_CP117340:c4193805-4193566 [Salmonella enterica subsp. enterica serovar Dublin]
MPGMSVRHKKTVSVTLEPALLQQARDAGINLSAVLTAALKEEISATGVERWKAENRAGLQELNRITDEHGLLSDDYRTF

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C6Z9V9

Antitoxin

Source ID Structure
AlphaFold DB A0A5H9SZK8

References