Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 824098..824758 | Replicon | chromosome |
| Accession | NZ_CP117340 | ||
| Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM111 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | Q57K70 |
| Locus tag | PQQ02_RS03975 | Protein ID | WP_000244756.1 |
| Coordinates | 824345..824758 (+) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S5MU13 |
| Locus tag | PQQ02_RS03970 | Protein ID | WP_000351186.1 |
| Coordinates | 824098..824364 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ02_RS03950 (820029) | 820029..821462 | - | 1434 | WP_001230141.1 | 6-phospho-beta-glucosidase BglA | - |
| PQQ02_RS03955 (821617) | 821617..821931 | + | 315 | WP_001182980.1 | N(4)-acetylcytidine aminohydrolase | - |
| PQQ02_RS03960 (822093) | 822093..822752 | + | 660 | WP_000250289.1 | hemolysin III family protein | - |
| PQQ02_RS03965 (822868) | 822868..823848 | - | 981 | WP_000874174.1 | tRNA-modifying protein YgfZ | - |
| PQQ02_RS03970 (824098) | 824098..824364 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
| PQQ02_RS03975 (824345) | 824345..824758 | + | 414 | WP_000244756.1 | protein YgfX | Toxin |
| PQQ02_RS03980 (824811) | 824811..825332 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
| PQQ02_RS03985 (825445) | 825445..826341 | + | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
| PQQ02_RS03990 (826365) | 826365..827078 | + | 714 | WP_000745614.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PQQ02_RS03995 (827084) | 827084..828817 | + | 1734 | WP_000813387.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16183.15 Da Isoelectric Point: 10.7537
>T270629 WP_000244756.1 NZ_CP117340:824345-824758 [Salmonella enterica subsp. enterica serovar Dublin]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Z1E9V5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0YWH4 |