Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 309876..310462 | Replicon | chromosome |
| Accession | NZ_CP117340 | ||
| Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM111 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | M7S4C0 |
| Locus tag | PQQ02_RS01420 | Protein ID | WP_001575091.1 |
| Coordinates | 310094..310462 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | M7SDJ3 |
| Locus tag | PQQ02_RS01415 | Protein ID | WP_001520924.1 |
| Coordinates | 309876..310097 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ02_RS01390 (304897) | 304897..306006 | + | 1110 | WP_000822976.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| PQQ02_RS01395 (306066) | 306066..306992 | + | 927 | WP_000003007.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| PQQ02_RS01400 (306989) | 306989..308266 | + | 1278 | WP_000803764.1 | branched chain amino acid ABC transporter permease LivM | - |
| PQQ02_RS01405 (308263) | 308263..309030 | + | 768 | WP_001751764.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| PQQ02_RS01410 (309032) | 309032..309745 | + | 714 | WP_000416114.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| PQQ02_RS01415 (309876) | 309876..310097 | + | 222 | WP_001520924.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PQQ02_RS01420 (310094) | 310094..310462 | + | 369 | WP_001575091.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| PQQ02_RS01425 (310721) | 310721..312037 | + | 1317 | WP_000624752.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| PQQ02_RS01430 (312142) | 312142..313029 | + | 888 | WP_000099303.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| PQQ02_RS01435 (313026) | 313026..313871 | + | 846 | WP_128297892.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| PQQ02_RS01440 (313873) | 313873..314943 | + | 1071 | WP_000907846.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 306989..315680 | 8691 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13701.98 Da Isoelectric Point: 5.6993
>T270627 WP_001575091.1 NZ_CP117340:310094-310462 [Salmonella enterica subsp. enterica serovar Dublin]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPERAEALMYRVLNQIEYEGVTDVWLLAAMHLLTISRGYIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPERAEALMYRVLNQIEYEGVTDVWLLAAMHLLTISRGYIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | M7S4C0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C6Z871 |