270627

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 309876..310462 Replicon chromosome
Accession NZ_CP117340
Organism Salmonella enterica subsp. enterica serovar Dublin strain RM111

Toxin (Protein)


Gene name doc Uniprot ID M7S4C0
Locus tag PQQ02_RS01420 Protein ID WP_001575091.1
Coordinates 310094..310462 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag PQQ02_RS01415 Protein ID WP_001520924.1
Coordinates 309876..310097 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ02_RS01390 (304897) 304897..306006 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
PQQ02_RS01395 (306066) 306066..306992 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
PQQ02_RS01400 (306989) 306989..308266 + 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
PQQ02_RS01405 (308263) 308263..309030 + 768 WP_001751764.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
PQQ02_RS01410 (309032) 309032..309745 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
PQQ02_RS01415 (309876) 309876..310097 + 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PQQ02_RS01420 (310094) 310094..310462 + 369 WP_001575091.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PQQ02_RS01425 (310721) 310721..312037 + 1317 WP_000624752.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
PQQ02_RS01430 (312142) 312142..313029 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
PQQ02_RS01435 (313026) 313026..313871 + 846 WP_128297892.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
PQQ02_RS01440 (313873) 313873..314943 + 1071 WP_000907846.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 306989..315680 8691


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(24-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13701.98 Da        Isoelectric Point: 5.6993

>T270627 WP_001575091.1 NZ_CP117340:310094-310462 [Salmonella enterica subsp. enterica serovar Dublin]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPERAEALMYRVLNQIEYEGVTDVWLLAAMHLLTISRGYIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT270627 WP_001520924.1 NZ_CP117340:309876-310097 [Salmonella enterica subsp. enterica serovar Dublin]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB M7S4C0

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References