Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3477044..3477664 | Replicon | chromosome |
| Accession | NZ_CP117338 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain RM095 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | PQP94_RS17180 | Protein ID | WP_001280991.1 |
| Coordinates | 3477446..3477664 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | PQP94_RS17175 | Protein ID | WP_000344807.1 |
| Coordinates | 3477044..3477418 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP94_RS17165 (3472183) | 3472183..3473376 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PQP94_RS17170 (3473399) | 3473399..3476548 | + | 3150 | WP_274895698.1 | efflux RND transporter permease AcrB | - |
| PQP94_RS17175 (3477044) | 3477044..3477418 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| PQP94_RS17180 (3477446) | 3477446..3477664 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| PQP94_RS17185 (3477843) | 3477843..3478394 | + | 552 | WP_274895699.1 | maltose O-acetyltransferase | - |
| PQP94_RS17190 (3478511) | 3478511..3478981 | + | 471 | WP_000136181.1 | YlaC family protein | - |
| PQP94_RS17195 (3479037) | 3479037..3479177 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| PQP94_RS17200 (3479183) | 3479183..3479443 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| PQP94_RS17205 (3479668) | 3479668..3481218 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
| PQP94_RS17215 (3481449) | 3481449..3481838 | + | 390 | WP_000961285.1 | MGMT family protein | - |
| PQP94_RS17220 (3481871) | 3481871..3482440 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T270617 WP_001280991.1 NZ_CP117338:3477446-3477664 [Salmonella enterica subsp. enterica serovar Typhimurium]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT270617 WP_000344807.1 NZ_CP117338:3477044-3477418 [Salmonella enterica subsp. enterica serovar Typhimurium]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|