Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 46346..47001 Replicon plasmid pRM052_1
Accession NZ_CP117337
Organism Salmonella enterica subsp. enterica serovar Dublin strain RM052

Toxin (Protein)


Gene name vagD Uniprot ID M7RF18
Locus tag PQP91_RS24020 Protein ID WP_000812999.1
Coordinates 46346..46774 (-) Length 143 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID H9AC95
Locus tag PQP91_RS24025 Protein ID WP_001261283.1
Coordinates 46771..47001 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP91_RS23985 (PQP91_23985) 41747..42511 + 765 WP_000827659.1 K88 minor fimbrial subunit faeI -
PQP91_RS23990 (PQP91_23990) 42498..42773 + 276 WP_001020576.1 hypothetical protein -
PQP91_RS23995 (PQP91_23995) 42773..43486 + 714 WP_000801115.1 hypothetical protein -
PQP91_RS24000 (PQP91_24000) 43611..44195 + 585 WP_001575501.1 hypothetical protein -
PQP91_RS24005 (PQP91_24005) 44268..44480 + 213 WP_000063794.1 FaeA/PapI family transcriptional regulator -
PQP91_RS24010 (PQP91_24010) 44741..44902 + 162 WP_001816720.1 hypothetical protein -
PQP91_RS24015 (PQP91_24015) 44928..45776 + 849 WP_000175391.1 SdiA-regulated domain-containing protein -
PQP91_RS24020 (PQP91_24020) 46346..46774 - 429 WP_000812999.1 type II toxin-antitoxin system VapC family toxin Toxin
PQP91_RS24025 (PQP91_24025) 46771..47001 - 231 WP_001261283.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PQP91_RS24030 (PQP91_24030) 47746..47964 + 219 WP_000813641.1 type II toxin-antitoxin system antitoxin CcdA -
PQP91_RS24035 (PQP91_24035) 47966..48271 + 306 WP_001159863.1 type II toxin-antitoxin system toxin CcdB -
PQP91_RS24040 (PQP91_24040) 48273..48563 + 291 WP_001266176.1 hypothetical protein -
PQP91_RS24045 (PQP91_24045) 48560..49081 + 522 WP_000198608.1 hypothetical protein -
PQP91_RS24050 (PQP91_24050) 49116..49898 + 783 WP_000082169.1 site-specific integrase -
PQP91_RS24055 (PQP91_24055) 49907..50590 + 684 WP_001751692.1 EAL domain-containing protein -
PQP91_RS24060 (PQP91_24060) 50644..51132 + 489 WP_001075507.1 CaiF/GrlA family transcriptional regulator -
PQP91_RS24065 (PQP91_24065) 51126..51462 + 337 Protein_67 hypothetical protein -
PQP91_RS24070 (PQP91_24070) 51453..51794 + 342 Protein_68 LysM peptidoglycan-binding domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 faeH / faeI / spvC / spvB 1..150540 150540


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(9-133)

Antitoxin

SpoVT-AbrB domain

(7-50)


Sequences

Toxin        


Download         Length: 143 a.a.        Molecular weight: 15483.03 Da        Isoelectric Point: 7.6736

>T270603 WP_000812999.1 NZ_CP117337:c46774-46346 [Salmonella enterica subsp. enterica serovar Dublin]
MKQPRTKTYMLDTCICSFIMREQSEAVLKRLEQAVLRGHRIVISAITYSEMRFGATGPKASPRLVQLVDAFCARLDAILP
WDRAAVDATTEIKVALCLAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVS

Download         Length: 429 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8737.83 Da        Isoelectric Point: 4.3775

>AT270603 WP_001261283.1 NZ_CP117337:c47001-46771 [Salmonella enterica subsp. enterica serovar Dublin]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQLEKADPDFMAEREDVVSDEGRFEL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB M7RF18

Antitoxin

Source ID Structure
AlphaFold DB A0A6X6R7C5

References