Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 46346..47001 | Replicon | plasmid pRM052_1 |
| Accession | NZ_CP117337 | ||
| Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM052 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | M7RF18 |
| Locus tag | PQP91_RS24020 | Protein ID | WP_000812999.1 |
| Coordinates | 46346..46774 (-) | Length | 143 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | H9AC95 |
| Locus tag | PQP91_RS24025 | Protein ID | WP_001261283.1 |
| Coordinates | 46771..47001 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP91_RS23985 (PQP91_23985) | 41747..42511 | + | 765 | WP_000827659.1 | K88 minor fimbrial subunit faeI | - |
| PQP91_RS23990 (PQP91_23990) | 42498..42773 | + | 276 | WP_001020576.1 | hypothetical protein | - |
| PQP91_RS23995 (PQP91_23995) | 42773..43486 | + | 714 | WP_000801115.1 | hypothetical protein | - |
| PQP91_RS24000 (PQP91_24000) | 43611..44195 | + | 585 | WP_001575501.1 | hypothetical protein | - |
| PQP91_RS24005 (PQP91_24005) | 44268..44480 | + | 213 | WP_000063794.1 | FaeA/PapI family transcriptional regulator | - |
| PQP91_RS24010 (PQP91_24010) | 44741..44902 | + | 162 | WP_001816720.1 | hypothetical protein | - |
| PQP91_RS24015 (PQP91_24015) | 44928..45776 | + | 849 | WP_000175391.1 | SdiA-regulated domain-containing protein | - |
| PQP91_RS24020 (PQP91_24020) | 46346..46774 | - | 429 | WP_000812999.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PQP91_RS24025 (PQP91_24025) | 46771..47001 | - | 231 | WP_001261283.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PQP91_RS24030 (PQP91_24030) | 47746..47964 | + | 219 | WP_000813641.1 | type II toxin-antitoxin system antitoxin CcdA | - |
| PQP91_RS24035 (PQP91_24035) | 47966..48271 | + | 306 | WP_001159863.1 | type II toxin-antitoxin system toxin CcdB | - |
| PQP91_RS24040 (PQP91_24040) | 48273..48563 | + | 291 | WP_001266176.1 | hypothetical protein | - |
| PQP91_RS24045 (PQP91_24045) | 48560..49081 | + | 522 | WP_000198608.1 | hypothetical protein | - |
| PQP91_RS24050 (PQP91_24050) | 49116..49898 | + | 783 | WP_000082169.1 | site-specific integrase | - |
| PQP91_RS24055 (PQP91_24055) | 49907..50590 | + | 684 | WP_001751692.1 | EAL domain-containing protein | - |
| PQP91_RS24060 (PQP91_24060) | 50644..51132 | + | 489 | WP_001075507.1 | CaiF/GrlA family transcriptional regulator | - |
| PQP91_RS24065 (PQP91_24065) | 51126..51462 | + | 337 | Protein_67 | hypothetical protein | - |
| PQP91_RS24070 (PQP91_24070) | 51453..51794 | + | 342 | Protein_68 | LysM peptidoglycan-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 | faeH / faeI / spvC / spvB | 1..150540 | 150540 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15483.03 Da Isoelectric Point: 7.6736
>T270603 WP_000812999.1 NZ_CP117337:c46774-46346 [Salmonella enterica subsp. enterica serovar Dublin]
MKQPRTKTYMLDTCICSFIMREQSEAVLKRLEQAVLRGHRIVISAITYSEMRFGATGPKASPRLVQLVDAFCARLDAILP
WDRAAVDATTEIKVALCLAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVS
MKQPRTKTYMLDTCICSFIMREQSEAVLKRLEQAVLRGHRIVISAITYSEMRFGATGPKASPRLVQLVDAFCARLDAILP
WDRAAVDATTEIKVALCLAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVS
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | M7RF18 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6X6R7C5 |