Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-DnaT |
Location | 823..1345 | Replicon | plasmid pRM052_1 |
Accession | NZ_CP117337 | ||
Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM052 |
Toxin (Protein)
Gene name | relE | Uniprot ID | G3CAN5 |
Locus tag | PQP91_RS23735 | Protein ID | WP_000220560.1 |
Coordinates | 1064..1345 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | G3CAG1 |
Locus tag | PQP91_RS23730 | Protein ID | WP_000121743.1 |
Coordinates | 823..1074 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP91_RS23730 (PQP91_23730) | 823..1074 | + | 252 | WP_000121743.1 | plasmid stabilization protein | Antitoxin |
PQP91_RS23735 (PQP91_23735) | 1064..1345 | + | 282 | WP_000220560.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PQP91_RS23740 (PQP91_23740) | 1491..1814 | + | 324 | WP_001181909.1 | hypothetical protein | - |
PQP91_RS23745 (PQP91_23745) | 1859..2104 | + | 246 | WP_000356542.1 | hypothetical protein | - |
PQP91_RS23750 (PQP91_23750) | 2094..2309 | + | 216 | WP_001180117.1 | hypothetical protein | - |
PQP91_RS23755 (PQP91_23755) | 2402..2731 | + | 330 | WP_000866650.1 | hypothetical protein | - |
PQP91_RS23760 (PQP91_23760) | 2774..2953 | + | 180 | WP_001575529.1 | hypothetical protein | - |
PQP91_RS23765 (PQP91_23765) | 2975..3172 | + | 198 | WP_001675595.1 | hypothetical protein | - |
PQP91_RS23770 (PQP91_23770) | 3185..3457 | + | 273 | WP_000160399.1 | hypothetical protein | - |
PQP91_RS23775 (PQP91_23775) | 3783..4328 | + | 546 | WP_000757691.1 | DNA distortion polypeptide 1 | - |
PQP91_RS23780 (PQP91_23780) | 4331..5512 | + | 1182 | WP_000539536.1 | MobP1 family relaxase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 | faeH / faeI / spvC / spvB | 1..150540 | 150540 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11005.83 Da Isoelectric Point: 10.5938
>T270602 WP_000220560.1 NZ_CP117337:1064-1345 [Salmonella enterica subsp. enterica serovar Dublin]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G3CAN5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3S5I301 |