Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4236689..4237205 | Replicon | chromosome |
| Accession | NZ_CP117336 | ||
| Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM052 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | M7RIY5 |
| Locus tag | PQP91_RS20875 | Protein ID | WP_000220574.1 |
| Coordinates | 4236689..4236973 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | PQP91_RS20880 | Protein ID | WP_000212724.1 |
| Coordinates | 4236963..4237205 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP91_RS20860 (4231805) | 4231805..4233457 | + | 1653 | WP_001751520.1 | alpha,alpha-phosphotrehalase | - |
| PQP91_RS20865 (4233866) | 4233866..4236004 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| PQP91_RS20870 (4236221) | 4236221..4236685 | + | 465 | WP_001009173.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| PQP91_RS20875 (4236689) | 4236689..4236973 | - | 285 | WP_000220574.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PQP91_RS20880 (4236963) | 4236963..4237205 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PQP91_RS20885 (4237283) | 4237283..4239196 | - | 1914 | WP_001212138.1 | PRD domain-containing protein | - |
| PQP91_RS20890 (4239213) | 4239213..4239953 | - | 741 | WP_000779259.1 | KDGP aldolase family protein | - |
| PQP91_RS20895 (4239950) | 4239950..4241068 | - | 1119 | WP_001139169.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| PQP91_RS20900 (4241052) | 4241052..4242185 | - | 1134 | WP_000459958.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10869.68 Da Isoelectric Point: 9.8739
>T270598 WP_000220574.1 NZ_CP117336:c4236973-4236689 [Salmonella enterica subsp. enterica serovar Dublin]
MTYELEFDPRALKEWHKLGDTVKAQIKKKLADVLLDPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQIKKKLADVLLDPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | M7RIY5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |