Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4195524..4196074 Replicon chromosome
Accession NZ_CP117336
Organism Salmonella enterica subsp. enterica serovar Dublin strain RM052

Toxin (Protein)


Gene name ccdB Uniprot ID M7RJ32
Locus tag PQP91_RS20670 Protein ID WP_001199743.1
Coordinates 4195524..4195832 (-) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID M7RP97
Locus tag PQP91_RS20675 Protein ID WP_001118105.1
Coordinates 4195835..4196074 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP91_RS20650 (4192098) 4192098..4192838 - 741 WP_001575372.1 SEF14/SEF18 fimbria chaperone SefB -
PQP91_RS20655 (4192960) 4192960..4193490 - 531 WP_000909460.1 SEF14 fimbria major subunit SefA -
PQP91_RS20660 (4193813) 4193813..4194946 + 1134 Protein_4044 IS3 family transposase -
PQP91_RS20665 (4194978) 4194978..4195118 - 141 Protein_4045 Arm DNA-binding domain-containing protein -
PQP91_RS20670 (4195524) 4195524..4195832 - 309 WP_001199743.1 CcdB family protein Toxin
PQP91_RS20675 (4195835) 4195835..4196074 - 240 WP_001118105.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
PQP91_RS20680 (4196183) 4196183..4196431 - 249 WP_000168389.1 ribbon-helix-helix domain-containing protein -
PQP91_RS20685 (4196622) 4196622..4197053 - 432 Protein_4049 helix-turn-helix domain-containing protein -
PQP91_RS20695 (4197810) 4197810..4198829 + 1020 WP_000152558.1 NAD(P)-dependent alcohol dehydrogenase -
PQP91_RS20700 (4198857) 4198857..4199387 - 531 WP_000896758.1 gluconokinase -
PQP91_RS20705 (4199604) 4199604..4200635 + 1032 WP_000453348.1 L-idonate 5-dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside IScluster/Tn - - 4193905..4197008 3103


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(9-79)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11845.67 Da        Isoelectric Point: 6.7228

>T270597 WP_001199743.1 NZ_CP117336:c4195832-4195524 [Salmonella enterica subsp. enterica serovar Dublin]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF

Download         Length: 309 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8719.90 Da        Isoelectric Point: 6.4633

>AT270597 WP_001118105.1 NZ_CP117336:c4196074-4195835 [Salmonella enterica subsp. enterica serovar Dublin]
MPGMSVRHKKTVSVTLEPALLQQARDAGINLSAVLTAALKEEISATGVERWKAENRAGLQELNRITDEHGLLSDDYRTF

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C6Z9V9

Antitoxin

Source ID Structure
AlphaFold DB A0A5H9SZK8

References