Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 4145279..4145855 | Replicon | chromosome |
Accession | NZ_CP117336 | ||
Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM052 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | M7RG88 |
Locus tag | PQP91_RS20435 | Protein ID | WP_001131963.1 |
Coordinates | 4145568..4145855 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | A0A5U1K3M6 |
Locus tag | PQP91_RS20430 | Protein ID | WP_000063141.1 |
Coordinates | 4145279..4145581 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP91_RS20415 (4141789) | 4141789..4143939 | + | 2151 | WP_000379928.1 | pyruvate/proton symporter BtsT | - |
PQP91_RS20420 (4144034) | 4144034..4144237 | + | 204 | WP_000460616.1 | YbdD/YjiX family protein | - |
PQP91_RS20425 (4144248) | 4144248..4145204 | + | 957 | WP_000187843.1 | GTPase | - |
PQP91_RS20430 (4145279) | 4145279..4145581 | - | 303 | WP_000063141.1 | BrnA antitoxin family protein | Antitoxin |
PQP91_RS20435 (4145568) | 4145568..4145855 | - | 288 | WP_001131963.1 | BrnT family toxin | Toxin |
PQP91_RS20440 (4146279) | 4146279..4148120 | + | 1842 | WP_000974635.1 | nuclease-related domain-containing DEAD/DEAH box helicase | - |
PQP91_RS20445 (4148733) | 4148733..4149308 | + | 576 | WP_000593782.1 | restriction endonuclease subunit S | - |
PQP91_RS20450 (4149313) | 4149313..4150377 | + | 1065 | WP_223151228.1 | N-6 DNA methylase | - |
PQP91_RS20455 (4150599) | 4150599..4150733 | - | 135 | WP_001055725.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11294.80 Da Isoelectric Point: 9.5894
>T270596 WP_001131963.1 NZ_CP117336:c4145855-4145568 [Salmonella enterica subsp. enterica serovar Dublin]
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11431.99 Da Isoelectric Point: 9.8948
>AT270596 WP_000063141.1 NZ_CP117336:c4145581-4145279 [Salmonella enterica subsp. enterica serovar Dublin]
MSMVKHKRGNASALSAQHEAELKALAKKSDDEIDYSDIPASEDGQWSEAVRDKFFRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLREQNKK
MSMVKHKRGNASALSAQHEAELKALAKKSDDEIDYSDIPASEDGQWSEAVRDKFFRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLREQNKK
Download Length: 303 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|