Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3545282..3545902 | Replicon | chromosome |
Accession | NZ_CP117336 | ||
Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM052 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PQP91_RS17670 | Protein ID | WP_001280991.1 |
Coordinates | 3545684..3545902 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | PQP91_RS17665 | Protein ID | WP_000344807.1 |
Coordinates | 3545282..3545656 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP91_RS17655 (3540421) | 3540421..3541614 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PQP91_RS17660 (3541637) | 3541637..3544786 | + | 3150 | WP_052897443.1 | efflux RND transporter permease AcrB | - |
PQP91_RS17665 (3545282) | 3545282..3545656 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
PQP91_RS17670 (3545684) | 3545684..3545902 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PQP91_RS17675 (3546081) | 3546081..3546632 | + | 552 | WP_001278787.1 | maltose O-acetyltransferase | - |
PQP91_RS17680 (3546750) | 3546750..3547220 | + | 471 | WP_000136183.1 | YlaC family protein | - |
PQP91_RS17685 (3547276) | 3547276..3547416 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PQP91_RS17690 (3547422) | 3547422..3547682 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PQP91_RS17695 (3547907) | 3547907..3549457 | + | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
PQP91_RS17705 (3549688) | 3549688..3550077 | + | 390 | WP_000961287.1 | MGMT family protein | - |
PQP91_RS17710 (3550110) | 3550110..3550679 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T270593 WP_001280991.1 NZ_CP117336:3545684-3545902 [Salmonella enterica subsp. enterica serovar Dublin]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT270593 WP_000344807.1 NZ_CP117336:3545282-3545656 [Salmonella enterica subsp. enterica serovar Dublin]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|