Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 45847..46376 | Replicon | plasmid pRM055_2 |
| Accession | NZ_CP117334 | ||
| Organism | Salmonella enterica subsp. enterica serovar Muenster strain RM055 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | PQP79_RS23470 | Protein ID | WP_274881778.1 |
| Coordinates | 46086..46376 (+) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | PQP79_RS23465 | Protein ID | WP_274881777.1 |
| Coordinates | 45847..46089 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP79_RS23435 (PQP79_23435) | 40883..41767 | - | 885 | WP_001447541.1 | DUF3363 domain-containing protein | - |
| PQP79_RS23440 (PQP79_23440) | 41798..43291 | - | 1494 | WP_001120888.1 | IS91-like element ISVsa3 family transposase | - |
| PQP79_RS23445 (PQP79_23445) | 43502..43726 | - | 225 | WP_000743213.1 | hypothetical protein | - |
| PQP79_RS23450 (PQP79_23450) | 43723..44460 | - | 738 | WP_001446887.1 | recombinase family protein | - |
| PQP79_RS23455 (PQP79_23455) | 44946..45086 | - | 141 | WP_001044210.1 | hypothetical protein | - |
| PQP79_RS23460 (PQP79_23460) | 45092..45796 | - | 705 | WP_274881769.1 | IS6-like element IS26 family transposase | - |
| PQP79_RS23465 (PQP79_23465) | 45847..46089 | + | 243 | WP_274881777.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| PQP79_RS23470 (PQP79_23470) | 46086..46376 | + | 291 | WP_274881778.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| PQP79_RS23475 (PQP79_23475) | 46680..47462 | - | 783 | WP_001531258.1 | IS21-like element ISSen3 family helper ATPase IstB | - |
| PQP79_RS23480 (PQP79_23480) | 47459..48481 | - | 1023 | WP_000627495.1 | IS21-like element ISSen3 family transposase | - |
| PQP79_RS23485 (PQP79_23485) | 48620..48844 | + | 225 | Protein_53 | hypothetical protein | - |
| PQP79_RS23490 (PQP79_23490) | 49281..49403 | + | 123 | WP_274880647.1 | hypothetical protein | - |
| PQP79_RS23495 (PQP79_23495) | 49437..49794 | + | 358 | Protein_55 | IS1 family transposase | - |
| PQP79_RS23500 (PQP79_23500) | 50481..50564 | + | 84 | Protein_56 | SOS response-associated peptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | dfrA12 / aadA2 / qacE / sul1 / sul2 / aph(3'')-Ib / aph(6)-Id / floR | - | 1..62867 | 62867 | |
| - | inside | IScluster/Tn | dfrA12 / aadA2 / qacE / sul1 / sul2 / aph(3'')-Ib / aph(6)-Id / floR | - | 20236..62673 | 42437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11353.39 Da Isoelectric Point: 10.3007
>T270582 WP_274881778.1 NZ_CP117334:46086-46376 [Salmonella enterica subsp. enterica serovar Muenster]
MKAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVG
KRERSEVYSEAVKRIL
MKAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVG
KRERSEVYSEAVKRIL
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|