Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 11304..11947 | Replicon | plasmid pRM055_2 |
| Accession | NZ_CP117334 | ||
| Organism | Salmonella enterica subsp. enterica serovar Muenster strain RM055 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | Q84A06 |
| Locus tag | PQP79_RS23285 | Protein ID | WP_000754566.1 |
| Coordinates | 11531..11947 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q84A07 |
| Locus tag | PQP79_RS23280 | Protein ID | WP_001261276.1 |
| Coordinates | 11304..11534 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP79_RS23245 (PQP79_23245) | 6423..6692 | + | 270 | WP_000339857.1 | hypothetical protein | - |
| PQP79_RS23250 (PQP79_23250) | 6869..7735 | - | 867 | WP_004118283.1 | replication initiation protein | - |
| PQP79_RS23255 (PQP79_23255) | 8265..8369 | + | 105 | WP_032409716.1 | hypothetical protein | - |
| PQP79_RS23260 (PQP79_23260) | 8498..8755 | + | 258 | WP_000764642.1 | hypothetical protein | - |
| PQP79_RS23265 (PQP79_23265) | 8813..9589 | - | 777 | WP_000015958.1 | site-specific integrase | - |
| PQP79_RS23270 (PQP79_23270) | 9586..10329 | - | 744 | WP_000129823.1 | hypothetical protein | - |
| PQP79_RS23275 (PQP79_23275) | 10380..10730 | - | 351 | WP_000493378.1 | hypothetical protein | - |
| PQP79_RS23280 (PQP79_23280) | 11304..11534 | + | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PQP79_RS23285 (PQP79_23285) | 11531..11947 | + | 417 | WP_000754566.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PQP79_RS23290 (PQP79_23290) | 12151..13286 | + | 1136 | WP_274881772.1 | IS3-like element ISEc15 family transposase | - |
| PQP79_RS23295 (PQP79_23295) | 13394..13990 | - | 597 | Protein_15 | S16 family serine protease | - |
| PQP79_RS23300 (PQP79_23300) | 14062..15182 | + | 1121 | WP_274881773.1 | IS3 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | dfrA12 / aadA2 / qacE / sul1 / sul2 / aph(3'')-Ib / aph(6)-Id / floR | - | 1..62867 | 62867 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15006.52 Da Isoelectric Point: 9.2957
>T270581 WP_000754566.1 NZ_CP117334:11531-11947 [Salmonella enterica subsp. enterica serovar Muenster]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K1G3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K023 |