Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4180900..4181681 | Replicon | chromosome |
Accession | NZ_CP117332 | ||
Organism | Salmonella enterica subsp. enterica serovar Muenster strain RM055 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A752VN12 |
Locus tag | PQP79_RS20350 | Protein ID | WP_000622305.1 |
Coordinates | 4180900..4181391 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | A0A3V4SIN7 |
Locus tag | PQP79_RS20355 | Protein ID | WP_001110453.1 |
Coordinates | 4181388..4181681 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP79_RS20325 (4176035) | 4176035..4178473 | - | 2439 | WP_023137200.1 | F4 (K88) fimbrial usher FaeD | - |
PQP79_RS20330 (4178483) | 4178483..4179022 | - | 540 | WP_000721295.1 | type 1 fimbrial protein | - |
PQP79_RS20335 (4179057) | 4179057..4179347 | - | 291 | WP_000773469.1 | PapB/FocB family fimbrial expression transcriptional regulator | - |
PQP79_RS20340 (4179934) | 4179934..4180161 | + | 228 | WP_001112992.1 | hypothetical protein | - |
PQP79_RS20345 (4180437) | 4180437..4180685 | - | 249 | Protein_3975 | IS481 family transposase | - |
PQP79_RS20350 (4180900) | 4180900..4181391 | - | 492 | WP_000622305.1 | GNAT family N-acetyltransferase | Toxin |
PQP79_RS20355 (4181388) | 4181388..4181681 | - | 294 | WP_001110453.1 | DUF1778 domain-containing protein | Antitoxin |
PQP79_RS20360 (4181999) | 4181999..4182221 | + | 223 | Protein_3978 | hypothetical protein | - |
PQP79_RS20365 (4182485) | 4182485..4183360 | + | 876 | WP_023137202.1 | AraC family transcriptional regulator | - |
PQP79_RS20370 (4183357) | 4183357..4183644 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
PQP79_RS20375 (4183637) | 4183637..4183819 | - | 183 | WP_001527266.1 | ATP-binding cassette domain-containing protein | - |
PQP79_RS20380 (4183839) | 4183839..4183938 | + | 100 | Protein_3982 | hypothetical protein | - |
PQP79_RS20385 (4184048) | 4184048..4184182 | + | 135 | Protein_3983 | hypothetical protein | - |
PQP79_RS20390 (4184477) | 4184477..4185382 | - | 906 | WP_001268209.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | faeI / faeH / faeF / faeE / faeD / faeC | 4169455..4183819 | 14364 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17606.43 Da Isoelectric Point: 7.7297
>T270574 WP_000622305.1 NZ_CP117332:c4181391-4180900 [Salmonella enterica subsp. enterica serovar Muenster]
MISAPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSSVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISAPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSSVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10948.57 Da Isoelectric Point: 9.8590
>AT270574 WP_001110453.1 NZ_CP117332:c4181681-4181388 [Salmonella enterica subsp. enterica serovar Muenster]
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPQAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPQAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A752VN12 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V4SIN7 |