Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4043302..4043818 | Replicon | chromosome |
Accession | NZ_CP117332 | ||
Organism | Salmonella enterica subsp. enterica serovar Muenster strain RM055 |
Toxin (Protein)
Gene name | relE | Uniprot ID | C0Q7A9 |
Locus tag | PQP79_RS19635 | Protein ID | WP_000220578.1 |
Coordinates | 4043302..4043586 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | PQP79_RS19640 | Protein ID | WP_000212724.1 |
Coordinates | 4043576..4043818 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP79_RS19620 (4038417) | 4038417..4040069 | + | 1653 | WP_023137279.1 | alpha,alpha-phosphotrehalase | - |
PQP79_RS19625 (4040479) | 4040479..4042617 | + | 2139 | WP_000187821.1 | anaerobic ribonucleoside-triphosphate reductase | - |
PQP79_RS19630 (4042834) | 4042834..4043298 | + | 465 | WP_001009178.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
PQP79_RS19635 (4043302) | 4043302..4043586 | - | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PQP79_RS19640 (4043576) | 4043576..4043818 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PQP79_RS19645 (4043896) | 4043896..4045809 | - | 1914 | WP_274880116.1 | BglG family transcription antiterminator | - |
PQP79_RS19650 (4045826) | 4045826..4046566 | - | 741 | WP_000779262.1 | KDGP aldolase family protein | - |
PQP79_RS19655 (4046563) | 4046563..4047681 | - | 1119 | WP_023137277.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
PQP79_RS19660 (4047665) | 4047665..4048798 | - | 1134 | WP_274881180.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T270573 WP_000220578.1 NZ_CP117332:c4043586-4043302 [Salmonella enterica subsp. enterica serovar Muenster]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E876 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |