Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ykfI-yfjZ/CbtA-CbeA
Location 3981746..3982472 Replicon chromosome
Accession NZ_CP117332
Organism Salmonella enterica subsp. enterica serovar Muenster strain RM055

Toxin (Protein)


Gene name ykfI Uniprot ID A0A248KBV8
Locus tag PQP79_RS19320 Protein ID WP_001194750.1
Coordinates 3981746..3982087 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID A0A613GX85
Locus tag PQP79_RS19325 Protein ID WP_023137305.1
Coordinates 3982131..3982472 (-) Length 114 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP79_RS19290 (3977252) 3977252..3977586 - 335 Protein_3769 Arm DNA-binding domain-containing protein -
PQP79_RS19300 (3979280) 3979280..3980077 - 798 WP_023137308.1 helix-turn-helix transcriptional regulator -
PQP79_RS19305 (3980193) 3980193..3980468 - 276 WP_000409332.1 type II toxin-antitoxin system RelE/ParE family toxin -
PQP79_RS19310 (3980472) 3980472..3980720 - 249 WP_023137307.1 ribbon-helix-helix domain-containing protein -
PQP79_RS19315 (3980797) 3980797..3981630 - 834 WP_274880107.1 DUF4942 domain-containing protein -
PQP79_RS19320 (3981746) 3981746..3982087 - 342 WP_001194750.1 TA system toxin CbtA family protein Toxin
PQP79_RS19325 (3982131) 3982131..3982472 - 342 WP_023137305.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
PQP79_RS19330 (3982495) 3982495..3982716 - 222 WP_023137304.1 DUF987 family protein -
PQP79_RS19335 (3982713) 3982713..3983213 - 501 WP_023137303.1 DNA repair protein RadC -
PQP79_RS19340 (3983226) 3983226..3984047 - 822 WP_023137302.1 DUF932 domain-containing protein -
PQP79_RS19345 (3984132) 3984132..3985046 - 915 WP_274881172.1 hypothetical protein -
PQP79_RS19350 (3985111) 3985111..3985314 - 204 WP_023137300.1 hypothetical protein -
PQP79_RS19355 (3985331) 3985331..3985477 - 147 WP_023892166.1 hypothetical protein -
PQP79_RS19360 (3985550) 3985550..3986090 - 541 Protein_3783 WYL domain-containing protein -
PQP79_RS19365 (3986445) 3986445..3986738 - 294 WP_000562957.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 3964069..4000941 36872


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(2-109)

Antitoxin

Antitoxin CbeA

(11-109)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13116.01 Da        Isoelectric Point: 9.7617

>T270572 WP_001194750.1 NZ_CP117332:c3982087-3981746 [Salmonella enterica subsp. enterica serovar Muenster]
MQTQYNHPHRATPSQPSPVEIWQKLLTHLLAKHYGLELSDTPFSVEKVIQEHIDAGITLANAVNFIVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRRQRYLAAH

Download         Length: 342 bp

Antitoxin


Download         Length: 114 a.a.        Molecular weight: 12816.64 Da        Isoelectric Point: 8.8958

>AT270572 WP_023137305.1 NZ_CP117332:c3982472-3982131 [Salmonella enterica subsp. enterica serovar Muenster]
MDTNETQSTPVWGLRNDVFPSFGARLVQEGNHLHYLADRAGIYGEFTPEQLKTLNIVFPMFIKRMEVALRTGALNPREAR
RFTTALRGITCEADTRGSFGYVYLSLYPTVVKN

Download         Length: 342 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A248KBV8

Antitoxin

Source ID Structure
AlphaFold DB A0A613GX85

References