Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3362347..3362967 | Replicon | chromosome |
Accession | NZ_CP117332 | ||
Organism | Salmonella enterica subsp. enterica serovar Muenster strain RM055 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PQP79_RS16450 | Protein ID | WP_001280991.1 |
Coordinates | 3362749..3362967 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | PQP79_RS16445 | Protein ID | WP_000344807.1 |
Coordinates | 3362347..3362721 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP79_RS16435 (3357486) | 3357486..3358679 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PQP79_RS16440 (3358702) | 3358702..3361851 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
PQP79_RS16445 (3362347) | 3362347..3362721 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
PQP79_RS16450 (3362749) | 3362749..3362967 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PQP79_RS16455 (3363146) | 3363146..3363697 | + | 552 | WP_274881085.1 | maltose O-acetyltransferase | - |
PQP79_RS16460 (3363815) | 3363815..3364285 | + | 471 | WP_000136183.1 | YlaC family protein | - |
PQP79_RS16465 (3364341) | 3364341..3364481 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PQP79_RS16470 (3364487) | 3364487..3364747 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PQP79_RS16475 (3364972) | 3364972..3366522 | + | 1551 | WP_023136501.1 | EAL domain-containing protein | - |
PQP79_RS16485 (3366753) | 3366753..3367142 | + | 390 | WP_000961285.1 | MGMT family protein | - |
PQP79_RS16490 (3367175) | 3367175..3367744 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T270571 WP_001280991.1 NZ_CP117332:3362749-3362967 [Salmonella enterica subsp. enterica serovar Muenster]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT270571 WP_000344807.1 NZ_CP117332:3362347-3362721 [Salmonella enterica subsp. enterica serovar Muenster]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|