Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2365909..2366431 | Replicon | chromosome |
Accession | NZ_CP117332 | ||
Organism | Salmonella enterica subsp. enterica serovar Muenster strain RM055 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | A0A5J1ICX1 |
Locus tag | PQP79_RS11470 | Protein ID | WP_000221344.1 |
Coordinates | 2366147..2366431 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | PQP79_RS11465 | Protein ID | WP_000885424.1 |
Coordinates | 2365909..2366157 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP79_RS11435 (2361925) | 2361925..2362032 | + | 108 | Protein_2234 | hypothetical protein | - |
PQP79_RS11440 (2362278) | 2362278..2363258 | - | 981 | WP_000876799.1 | nitronate monooxygenase | - |
PQP79_RS11445 (2363432) | 2363432..2364340 | - | 909 | WP_274879769.1 | LysR family transcriptional regulator | - |
PQP79_RS11450 (2364742) | 2364742..2364945 | + | 204 | WP_001276024.1 | DUF29 family protein | - |
PQP79_RS11455 (2365220) | 2365220..2365552 | - | 333 | WP_000253078.1 | DUF1493 family protein | - |
PQP79_RS11460 (2365638) | 2365638..2365757 | - | 120 | Protein_2239 | type II and III secretion system | - |
PQP79_RS11465 (2365909) | 2365909..2366157 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PQP79_RS11470 (2366147) | 2366147..2366431 | + | 285 | WP_000221344.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PQP79_RS11475 (2366550) | 2366550..2366831 | + | 282 | Protein_2242 | RidA family protein | - |
PQP79_RS11480 (2366883) | 2366883..2367962 | - | 1080 | WP_274880955.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
PQP79_RS11485 (2368155) | 2368155..2368643 | - | 489 | WP_023137021.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
PQP79_RS11490 (2368688) | 2368688..2370196 | + | 1509 | WP_023223293.1 | FAD-dependent oxidoreductase | - |
PQP79_RS11495 (2370186) | 2370186..2371427 | + | 1242 | WP_001095734.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11015.73 Da Isoelectric Point: 10.5388
>T270570 WP_000221344.1 NZ_CP117332:2366147-2366431 [Salmonella enterica subsp. enterica serovar Muenster]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTQHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTQHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5J1ICX1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |