Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 1870950..1871540 | Replicon | chromosome |
| Accession | NZ_CP117332 | ||
| Organism | Salmonella enterica subsp. enterica serovar Muenster strain RM055 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | A0A5V3ZYQ4 |
| Locus tag | PQP79_RS08875 | Protein ID | WP_023137319.1 |
| Coordinates | 1870950..1871282 (-) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A613PBF1 |
| Locus tag | PQP79_RS08880 | Protein ID | WP_023137318.1 |
| Coordinates | 1871283..1871540 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP79_RS08865 (1867325) | 1867325..1868587 | + | 1263 | WP_023137322.1 | integrase arm-type DNA-binding domain-containing protein | - |
| PQP79_RS08870 (1869215) | 1869215..1870099 | - | 885 | WP_023137321.1 | integrase domain-containing protein | - |
| PQP79_RS08875 (1870950) | 1870950..1871282 | - | 333 | WP_023137319.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PQP79_RS08880 (1871283) | 1871283..1871540 | - | 258 | WP_023137318.1 | hypothetical protein | Antitoxin |
| PQP79_RS08885 (1871888) | 1871888..1872094 | - | 207 | WP_023137317.1 | helix-turn-helix transcriptional regulator | - |
| PQP79_RS08890 (1872091) | 1872091..1872570 | - | 480 | WP_023137316.1 | hypothetical protein | - |
| PQP79_RS08895 (1873208) | 1873208..1875250 | - | 2043 | WP_274880513.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11809.59 Da Isoelectric Point: 9.3417
>T270565 WP_023137319.1 NZ_CP117332:c1871282-1870950 [Salmonella enterica subsp. enterica serovar Muenster]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSQASFNKLTRLPVVVPVTSGGNFARAAGFTVSLDDAGTKTTGVIRCDQPRTI
DMGARNGKRLERIPDAVVNEVLARLEAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSQASFNKLTRLPVVVPVTSGGNFARAAGFTVSLDDAGTKTTGVIRCDQPRTI
DMGARNGKRLERIPDAVVNEVLARLEAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5V3ZYQ4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A613PBF1 |