Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 316792..317378 | Replicon | chromosome |
Accession | NZ_CP117332 | ||
Organism | Salmonella enterica subsp. enterica serovar Muenster strain RM055 |
Toxin (Protein)
Gene name | doc | Uniprot ID | A0A5Z7YLS5 |
Locus tag | PQP79_RS01450 | Protein ID | WP_001549713.1 |
Coordinates | 317010..317378 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | PQP79_RS01445 | Protein ID | WP_023136533.1 |
Coordinates | 316792..317013 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP79_RS01420 (311813) | 311813..312922 | + | 1110 | WP_000822976.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
PQP79_RS01425 (312982) | 312982..313908 | + | 927 | WP_000003007.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
PQP79_RS01430 (313905) | 313905..315182 | + | 1278 | WP_000803764.1 | branched chain amino acid ABC transporter permease LivM | - |
PQP79_RS01435 (315179) | 315179..315946 | + | 768 | WP_274881288.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
PQP79_RS01440 (315948) | 315948..316661 | + | 714 | WP_000416114.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
PQP79_RS01445 (316792) | 316792..317013 | + | 222 | WP_023136533.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PQP79_RS01450 (317010) | 317010..317378 | + | 369 | WP_001549713.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
PQP79_RS01455 (317637) | 317637..318953 | + | 1317 | WP_274881289.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
PQP79_RS01460 (319058) | 319058..319945 | + | 888 | WP_000099303.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
PQP79_RS01465 (319942) | 319942..320787 | + | 846 | WP_274881290.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
PQP79_RS01470 (320790) | 320790..321860 | + | 1071 | WP_000907842.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 313905..322597 | 8692 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13559.83 Da Isoelectric Point: 6.7252
>T270563 WP_001549713.1 NZ_CP117332:317010-317378 [Salmonella enterica subsp. enterica serovar Muenster]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGVSLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGVSLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|