Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 316792..317378 Replicon chromosome
Accession NZ_CP117332
Organism Salmonella enterica subsp. enterica serovar Muenster strain RM055

Toxin (Protein)


Gene name doc Uniprot ID A0A5Z7YLS5
Locus tag PQP79_RS01450 Protein ID WP_001549713.1
Coordinates 317010..317378 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID -
Locus tag PQP79_RS01445 Protein ID WP_023136533.1
Coordinates 316792..317013 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP79_RS01420 (311813) 311813..312922 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
PQP79_RS01425 (312982) 312982..313908 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
PQP79_RS01430 (313905) 313905..315182 + 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
PQP79_RS01435 (315179) 315179..315946 + 768 WP_274881288.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
PQP79_RS01440 (315948) 315948..316661 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
PQP79_RS01445 (316792) 316792..317013 + 222 WP_023136533.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PQP79_RS01450 (317010) 317010..317378 + 369 WP_001549713.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PQP79_RS01455 (317637) 317637..318953 + 1317 WP_274881289.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
PQP79_RS01460 (319058) 319058..319945 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
PQP79_RS01465 (319942) 319942..320787 + 846 WP_274881290.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
PQP79_RS01470 (320790) 320790..321860 + 1071 WP_000907842.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 313905..322597 8692


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13559.83 Da        Isoelectric Point: 6.7252

>T270563 WP_001549713.1 NZ_CP117332:317010-317378 [Salmonella enterica subsp. enterica serovar Muenster]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGVSLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8196.26 Da        Isoelectric Point: 5.0775

>AT270563 WP_023136533.1 NZ_CP117332:316792-317013 [Salmonella enterica subsp. enterica serovar Muenster]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQMARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5Z7YLS5

Antitoxin

Source ID Structure

References