Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 47266..47792 | Replicon | plasmid pRM074_1 |
Accession | NZ_CP117330 | ||
Organism | Salmonella enterica subsp. enterica serovar Muenster strain RM074 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | PQP80_RS23440 | Protein ID | WP_000323025.1 |
Coordinates | 47505..47792 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q5J3S4 |
Locus tag | PQP80_RS23435 | Protein ID | WP_000534857.1 |
Coordinates | 47266..47505 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP80_RS23400 (PQP80_23400) | 43502..43726 | - | 225 | WP_000743213.1 | hypothetical protein | - |
PQP80_RS23405 (PQP80_23405) | 43723..44460 | - | 738 | WP_001446887.1 | recombinase family protein | - |
PQP80_RS23410 (PQP80_23410) | 44946..45086 | - | 141 | WP_001044210.1 | hypothetical protein | - |
PQP80_RS23415 (PQP80_23415) | 45092..45796 | - | 705 | WP_274880641.1 | IS6-like element IS26 family transposase | - |
PQP80_RS23420 (PQP80_23420) | 45808..46731 | - | 924 | WP_274880643.1 | HsdR | - |
PQP80_RS23425 (PQP80_23425) | 46775..46924 | - | 150 | WP_000550473.1 | hypothetical protein | - |
PQP80_RS23430 (PQP80_23430) | 47131..47241 | - | 111 | Protein_51 | protein YdfV | - |
PQP80_RS23435 (PQP80_23435) | 47266..47505 | + | 240 | WP_000534857.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
PQP80_RS23440 (PQP80_23440) | 47505..47792 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
PQP80_RS23445 (PQP80_23445) | 48096..48878 | - | 783 | WP_001531258.1 | IS21-like element ISSen3 family helper ATPase IstB | - |
PQP80_RS23450 (PQP80_23450) | 48875..49897 | - | 1023 | WP_000627495.1 | IS21-like element ISSen3 family transposase | - |
PQP80_RS23455 (PQP80_23455) | 50036..50260 | + | 225 | Protein_56 | hypothetical protein | - |
PQP80_RS23460 (PQP80_23460) | 50697..50819 | + | 123 | WP_274880647.1 | hypothetical protein | - |
PQP80_RS23465 (PQP80_23465) | 50853..51210 | + | 358 | Protein_58 | IS1 family transposase | - |
PQP80_RS23470 (PQP80_23470) | 51897..51980 | + | 84 | Protein_59 | SOS response-associated peptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | dfrA12 / aadA2 / qacE / sul1 / sul2 / aph(3'')-Ib / aph(6)-Id / floR | - | 1..64283 | 64283 | |
- | inside | IScluster/Tn | dfrA12 / aadA2 / qacE / sul1 / sul2 / aph(3'')-Ib / aph(6)-Id / floR | - | 20236..64089 | 43853 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T270561 WP_000323025.1 NZ_CP117330:47505-47792 [Salmonella enterica subsp. enterica serovar Muenster]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|