Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 11304..11947 Replicon plasmid pRM074_1
Accession NZ_CP117330
Organism Salmonella enterica subsp. enterica serovar Muenster strain RM074

Toxin (Protein)


Gene name vagD Uniprot ID Q84A06
Locus tag PQP80_RS23240 Protein ID WP_000754566.1
Coordinates 11531..11947 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag PQP80_RS23235 Protein ID WP_001261276.1
Coordinates 11304..11534 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP80_RS23200 (PQP80_23200) 6423..6692 + 270 WP_000339857.1 hypothetical protein -
PQP80_RS23205 (PQP80_23205) 6869..7735 - 867 WP_004118283.1 replication initiation protein -
PQP80_RS23210 (PQP80_23210) 8265..8369 + 105 WP_032409716.1 hypothetical protein -
PQP80_RS23215 (PQP80_23215) 8498..8755 + 258 WP_000764642.1 hypothetical protein -
PQP80_RS23220 (PQP80_23220) 8813..9589 - 777 WP_000015958.1 site-specific integrase -
PQP80_RS23225 (PQP80_23225) 9586..10329 - 744 WP_000129823.1 hypothetical protein -
PQP80_RS23230 (PQP80_23230) 10380..10730 - 351 WP_000493378.1 hypothetical protein -
PQP80_RS23235 (PQP80_23235) 11304..11534 + 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PQP80_RS23240 (PQP80_23240) 11531..11947 + 417 WP_000754566.1 type II toxin-antitoxin system VapC family toxin Toxin
PQP80_RS23245 (PQP80_23245) 12151..13286 + 1136 WP_274880656.1 IS3-like element ISEc15 family transposase -
PQP80_RS23250 (PQP80_23250) 13394..13990 - 597 Protein_15 S16 family serine protease -
PQP80_RS23255 (PQP80_23255) 14062..15182 + 1121 WP_088765928.1 IS3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid dfrA12 / aadA2 / qacE / sul1 / sul2 / aph(3'')-Ib / aph(6)-Id / floR - 1..64283 64283


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15006.52 Da        Isoelectric Point: 9.2957

>T270560 WP_000754566.1 NZ_CP117330:11531-11947 [Salmonella enterica subsp. enterica serovar Muenster]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT270560 WP_001261276.1 NZ_CP117330:11304-11534 [Salmonella enterica subsp. enterica serovar Muenster]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A387K1G3

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References