Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4231132..4231913 | Replicon | chromosome |
Accession | NZ_CP117329 | ||
Organism | Salmonella enterica subsp. enterica serovar Muenster strain RM074 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A752VN12 |
Locus tag | PQP80_RS20755 | Protein ID | WP_000622305.1 |
Coordinates | 4231132..4231623 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | A0A3V4SIN7 |
Locus tag | PQP80_RS20760 | Protein ID | WP_001110453.1 |
Coordinates | 4231620..4231913 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP80_RS20730 (4226267) | 4226267..4228705 | - | 2439 | WP_023137200.1 | F4 (K88) fimbrial usher FaeD | - |
PQP80_RS20735 (4228715) | 4228715..4229254 | - | 540 | WP_000721295.1 | type 1 fimbrial protein | - |
PQP80_RS20740 (4229289) | 4229289..4229579 | - | 291 | WP_274880131.1 | PapB/FocB family fimbrial expression transcriptional regulator | - |
PQP80_RS20745 (4230166) | 4230166..4230393 | + | 228 | WP_001112992.1 | hypothetical protein | - |
PQP80_RS20750 (4230669) | 4230669..4230917 | - | 249 | Protein_4055 | IS481 family transposase | - |
PQP80_RS20755 (4231132) | 4231132..4231623 | - | 492 | WP_000622305.1 | GNAT family N-acetyltransferase | Toxin |
PQP80_RS20760 (4231620) | 4231620..4231913 | - | 294 | WP_001110453.1 | DUF1778 domain-containing protein | Antitoxin |
PQP80_RS20765 (4232231) | 4232231..4232453 | + | 223 | Protein_4058 | hypothetical protein | - |
PQP80_RS20770 (4232717) | 4232717..4233592 | + | 876 | WP_023137202.1 | AraC family transcriptional regulator | - |
PQP80_RS20775 (4233589) | 4233589..4233876 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
PQP80_RS20780 (4233869) | 4233869..4234051 | - | 183 | WP_001527266.1 | ATP-binding cassette domain-containing protein | - |
PQP80_RS20785 (4234071) | 4234071..4234170 | + | 100 | Protein_4062 | hypothetical protein | - |
PQP80_RS20790 (4234280) | 4234280..4234414 | + | 135 | Protein_4063 | hypothetical protein | - |
PQP80_RS20795 (4234709) | 4234709..4235614 | - | 906 | WP_001268209.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | faeI / faeH / faeF / faeE / faeD / faeC | 4219687..4234051 | 14364 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17606.43 Da Isoelectric Point: 7.7297
>T270557 WP_000622305.1 NZ_CP117329:c4231623-4231132 [Salmonella enterica subsp. enterica serovar Muenster]
MISAPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSSVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISAPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSSVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10948.57 Da Isoelectric Point: 9.8590
>AT270557 WP_001110453.1 NZ_CP117329:c4231913-4231620 [Salmonella enterica subsp. enterica serovar Muenster]
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPQAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPQAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A752VN12 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V4SIN7 |