Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4093535..4094051 | Replicon | chromosome |
Accession | NZ_CP117329 | ||
Organism | Salmonella enterica subsp. enterica serovar Muenster strain RM074 |
Toxin (Protein)
Gene name | relE | Uniprot ID | C0Q7A9 |
Locus tag | PQP80_RS20040 | Protein ID | WP_000220578.1 |
Coordinates | 4093535..4093819 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | PQP80_RS20045 | Protein ID | WP_000212724.1 |
Coordinates | 4093809..4094051 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP80_RS20025 (4088650) | 4088650..4090302 | + | 1653 | WP_023137279.1 | alpha,alpha-phosphotrehalase | - |
PQP80_RS20030 (4090712) | 4090712..4092850 | + | 2139 | WP_000187821.1 | anaerobic ribonucleoside-triphosphate reductase | - |
PQP80_RS20035 (4093067) | 4093067..4093531 | + | 465 | WP_001009178.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
PQP80_RS20040 (4093535) | 4093535..4093819 | - | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PQP80_RS20045 (4093809) | 4093809..4094051 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PQP80_RS20050 (4094129) | 4094129..4096042 | - | 1914 | WP_274880116.1 | BglG family transcription antiterminator | - |
PQP80_RS20055 (4096059) | 4096059..4096799 | - | 741 | WP_000779262.1 | KDGP aldolase family protein | - |
PQP80_RS20060 (4096796) | 4096796..4097914 | - | 1119 | WP_023137277.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
PQP80_RS20065 (4097898) | 4097898..4099031 | - | 1134 | Protein_3922 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T270556 WP_000220578.1 NZ_CP117329:c4093819-4093535 [Salmonella enterica subsp. enterica serovar Muenster]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E876 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |