Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ykfI-yfjZ/CbtA-CbeA
Location 4031980..4032706 Replicon chromosome
Accession NZ_CP117329
Organism Salmonella enterica subsp. enterica serovar Muenster strain RM074

Toxin (Protein)


Gene name ykfI Uniprot ID A0A248KBV8
Locus tag PQP80_RS19725 Protein ID WP_001194750.1
Coordinates 4031980..4032321 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID A0A613GX85
Locus tag PQP80_RS19730 Protein ID WP_023137305.1
Coordinates 4032365..4032706 (-) Length 114 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP80_RS19695 (4027486) 4027486..4027820 - 335 Protein_3849 Arm DNA-binding domain-containing protein -
PQP80_RS19705 (4029514) 4029514..4030311 - 798 WP_023137308.1 helix-turn-helix transcriptional regulator -
PQP80_RS19710 (4030427) 4030427..4030702 - 276 WP_000409332.1 type II toxin-antitoxin system RelE/ParE family toxin -
PQP80_RS19715 (4030706) 4030706..4030954 - 249 WP_023137307.1 ribbon-helix-helix domain-containing protein -
PQP80_RS19720 (4031031) 4031031..4031864 - 834 WP_274880107.1 DUF4942 domain-containing protein -
PQP80_RS19725 (4031980) 4031980..4032321 - 342 WP_001194750.1 TA system toxin CbtA family protein Toxin
PQP80_RS19730 (4032365) 4032365..4032706 - 342 WP_023137305.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
PQP80_RS19735 (4032729) 4032729..4032950 - 222 WP_023137304.1 DUF987 family protein -
PQP80_RS19740 (4032947) 4032947..4033447 - 501 WP_023137303.1 DNA repair protein RadC -
PQP80_RS19745 (4033460) 4033460..4034281 - 822 WP_023137302.1 DUF932 domain-containing protein -
PQP80_RS19750 (4034366) 4034366..4035280 - 915 WP_274880110.1 hypothetical protein -
PQP80_RS19755 (4035345) 4035345..4035548 - 204 WP_023137300.1 hypothetical protein -
PQP80_RS19760 (4035565) 4035565..4035783 - 219 WP_000928654.1 hypothetical protein -
PQP80_RS19765 (4035784) 4035784..4036324 - 541 Protein_3863 WYL domain-containing protein -
PQP80_RS19770 (4036679) 4036679..4036972 - 294 WP_000562957.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4014304..4051175 36871
- inside Genomic island - - 4014304..4051581 37277


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(2-109)

Antitoxin

Antitoxin CbeA

(11-109)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13116.01 Da        Isoelectric Point: 9.7617

>T270555 WP_001194750.1 NZ_CP117329:c4032321-4031980 [Salmonella enterica subsp. enterica serovar Muenster]
MQTQYNHPHRATPSQPSPVEIWQKLLTHLLAKHYGLELSDTPFSVEKVIQEHIDAGITLANAVNFIVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRRQRYLAAH

Download         Length: 342 bp

Antitoxin


Download         Length: 114 a.a.        Molecular weight: 12816.64 Da        Isoelectric Point: 8.8958

>AT270555 WP_023137305.1 NZ_CP117329:c4032706-4032365 [Salmonella enterica subsp. enterica serovar Muenster]
MDTNETQSTPVWGLRNDVFPSFGARLVQEGNHLHYLADRAGIYGEFTPEQLKTLNIVFPMFIKRMEVALRTGALNPREAR
RFTTALRGITCEADTRGSFGYVYLSLYPTVVKN

Download         Length: 342 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A248KBV8

Antitoxin

Source ID Structure
AlphaFold DB A0A613GX85

References