Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3412594..3413214 | Replicon | chromosome |
Accession | NZ_CP117329 | ||
Organism | Salmonella enterica subsp. enterica serovar Muenster strain RM074 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PQP80_RS16855 | Protein ID | WP_001280991.1 |
Coordinates | 3412996..3413214 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | PQP80_RS16850 | Protein ID | WP_000344807.1 |
Coordinates | 3412594..3412968 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP80_RS16840 (3407733) | 3407733..3408926 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PQP80_RS16845 (3408949) | 3408949..3412098 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
PQP80_RS16850 (3412594) | 3412594..3412968 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
PQP80_RS16855 (3412996) | 3412996..3413214 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PQP80_RS16860 (3413393) | 3413393..3413944 | + | 552 | WP_274880007.1 | maltose O-acetyltransferase | - |
PQP80_RS16865 (3414062) | 3414062..3414532 | + | 471 | WP_000136183.1 | YlaC family protein | - |
PQP80_RS16870 (3414588) | 3414588..3414728 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PQP80_RS16875 (3414734) | 3414734..3414994 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PQP80_RS16880 (3415219) | 3415219..3416769 | + | 1551 | WP_023136501.1 | EAL domain-containing protein | - |
PQP80_RS16890 (3417000) | 3417000..3417389 | + | 390 | WP_000961285.1 | MGMT family protein | - |
PQP80_RS16895 (3417422) | 3417422..3417991 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T270554 WP_001280991.1 NZ_CP117329:3412996-3413214 [Salmonella enterica subsp. enterica serovar Muenster]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT270554 WP_000344807.1 NZ_CP117329:3412594-3412968 [Salmonella enterica subsp. enterica serovar Muenster]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|