Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2415972..2416494 | Replicon | chromosome |
Accession | NZ_CP117329 | ||
Organism | Salmonella enterica subsp. enterica serovar Muenster strain RM074 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | A0A5J1ICX1 |
Locus tag | PQP80_RS11870 | Protein ID | WP_000221344.1 |
Coordinates | 2416210..2416494 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | PQP80_RS11865 | Protein ID | WP_000885424.1 |
Coordinates | 2415972..2416220 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP80_RS11835 (2411988) | 2411988..2412095 | + | 108 | Protein_2314 | hypothetical protein | - |
PQP80_RS11840 (2412341) | 2412341..2413321 | - | 981 | WP_000876799.1 | nitronate monooxygenase | - |
PQP80_RS11845 (2413495) | 2413495..2414403 | - | 909 | WP_274879769.1 | LysR family transcriptional regulator | - |
PQP80_RS11850 (2414805) | 2414805..2415008 | + | 204 | WP_001276024.1 | DUF29 family protein | - |
PQP80_RS11855 (2415283) | 2415283..2415615 | - | 333 | WP_000253078.1 | DUF1493 family protein | - |
PQP80_RS11860 (2415701) | 2415701..2415820 | - | 120 | Protein_2319 | type II and III secretion system | - |
PQP80_RS11865 (2415972) | 2415972..2416220 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PQP80_RS11870 (2416210) | 2416210..2416494 | + | 285 | WP_000221344.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PQP80_RS11875 (2416613) | 2416613..2416894 | + | 282 | Protein_2322 | RidA family protein | - |
PQP80_RS11880 (2416946) | 2416946..2418025 | - | 1080 | WP_274879770.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
PQP80_RS11885 (2418218) | 2418218..2418706 | - | 489 | WP_023137021.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
PQP80_RS11890 (2418751) | 2418751..2420259 | + | 1509 | WP_023223293.1 | FAD-dependent oxidoreductase | - |
PQP80_RS11895 (2420249) | 2420249..2421490 | + | 1242 | WP_001095734.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11015.73 Da Isoelectric Point: 10.5388
>T270553 WP_000221344.1 NZ_CP117329:2416210-2416494 [Salmonella enterica subsp. enterica serovar Muenster]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTQHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTQHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5J1ICX1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |