Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 1921511..1922101 | Replicon | chromosome |
| Accession | NZ_CP117329 | ||
| Organism | Salmonella enterica subsp. enterica serovar Muenster strain RM074 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | A0A5V3ZYQ4 |
| Locus tag | PQP80_RS09275 | Protein ID | WP_023137319.1 |
| Coordinates | 1921511..1921843 (-) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A613PBF1 |
| Locus tag | PQP80_RS09280 | Protein ID | WP_023137318.1 |
| Coordinates | 1921844..1922101 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP80_RS09265 (1917886) | 1917886..1919148 | + | 1263 | WP_023137322.1 | integrase arm-type DNA-binding domain-containing protein | - |
| PQP80_RS09270 (1919776) | 1919776..1920660 | - | 885 | WP_023137321.1 | integrase domain-containing protein | - |
| PQP80_RS09275 (1921511) | 1921511..1921843 | - | 333 | WP_023137319.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PQP80_RS09280 (1921844) | 1921844..1922101 | - | 258 | WP_023137318.1 | hypothetical protein | Antitoxin |
| PQP80_RS09285 (1922202) | 1922202..1922390 | + | 189 | WP_223120927.1 | hypothetical protein | - |
| PQP80_RS09290 (1922449) | 1922449..1922655 | - | 207 | WP_023137317.1 | helix-turn-helix transcriptional regulator | - |
| PQP80_RS09295 (1922652) | 1922652..1923131 | - | 480 | WP_023137316.1 | hypothetical protein | - |
| PQP80_RS09300 (1923769) | 1923769..1925811 | - | 2043 | WP_274880513.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11809.59 Da Isoelectric Point: 9.3417
>T270548 WP_023137319.1 NZ_CP117329:c1921843-1921511 [Salmonella enterica subsp. enterica serovar Muenster]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSQASFNKLTRLPVVVPVTSGGNFARAAGFTVSLDDAGTKTTGVIRCDQPRTI
DMGARNGKRLERIPDAVVNEVLARLEAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSQASFNKLTRLPVVVPVTSGGNFARAAGFTVSLDDAGTKTTGVIRCDQPRTI
DMGARNGKRLERIPDAVVNEVLARLEAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5V3ZYQ4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A613PBF1 |