Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 316788..317374 | Replicon | chromosome |
| Accession | NZ_CP117329 | ||
| Organism | Salmonella enterica subsp. enterica serovar Muenster strain RM074 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | A0A5Z7YLS5 |
| Locus tag | PQP80_RS01450 | Protein ID | WP_001549713.1 |
| Coordinates | 317006..317374 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | - |
| Locus tag | PQP80_RS01445 | Protein ID | WP_023136533.1 |
| Coordinates | 316788..317009 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP80_RS01420 (311811) | 311811..312920 | + | 1110 | WP_000822976.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| PQP80_RS01425 (312980) | 312980..313906 | + | 927 | WP_000003007.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| PQP80_RS01430 (313903) | 313903..315180 | + | 1278 | WP_274880201.1 | branched chain amino acid ABC transporter permease LivM | - |
| PQP80_RS01435 (315177) | 315177..315944 | + | 768 | WP_000082083.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| PQP80_RS01440 (315946) | 315946..316658 | + | 713 | Protein_283 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| PQP80_RS01445 (316788) | 316788..317009 | + | 222 | WP_023136533.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PQP80_RS01450 (317006) | 317006..317374 | + | 369 | WP_001549713.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| PQP80_RS01455 (317633) | 317633..318949 | + | 1317 | WP_274880202.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| PQP80_RS01460 (319054) | 319054..319941 | + | 888 | WP_000099303.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| PQP80_RS01465 (319938) | 319938..320783 | + | 846 | WP_000572196.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| PQP80_RS01470 (320786) | 320786..321856 | + | 1071 | WP_000907842.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 313903..322593 | 8690 | |
| - | inside | Prophage | - | - | 306569..322593 | 16024 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13559.83 Da Isoelectric Point: 6.7252
>T270546 WP_001549713.1 NZ_CP117329:317006-317374 [Salmonella enterica subsp. enterica serovar Muenster]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGVSLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGVSLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|