Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 316788..317374 Replicon chromosome
Accession NZ_CP117329
Organism Salmonella enterica subsp. enterica serovar Muenster strain RM074

Toxin (Protein)


Gene name doc Uniprot ID A0A5Z7YLS5
Locus tag PQP80_RS01450 Protein ID WP_001549713.1
Coordinates 317006..317374 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID -
Locus tag PQP80_RS01445 Protein ID WP_023136533.1
Coordinates 316788..317009 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP80_RS01420 (311811) 311811..312920 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
PQP80_RS01425 (312980) 312980..313906 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
PQP80_RS01430 (313903) 313903..315180 + 1278 WP_274880201.1 branched chain amino acid ABC transporter permease LivM -
PQP80_RS01435 (315177) 315177..315944 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
PQP80_RS01440 (315946) 315946..316658 + 713 Protein_283 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
PQP80_RS01445 (316788) 316788..317009 + 222 WP_023136533.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PQP80_RS01450 (317006) 317006..317374 + 369 WP_001549713.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PQP80_RS01455 (317633) 317633..318949 + 1317 WP_274880202.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
PQP80_RS01460 (319054) 319054..319941 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
PQP80_RS01465 (319938) 319938..320783 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
PQP80_RS01470 (320786) 320786..321856 + 1071 WP_000907842.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 313903..322593 8690
- inside Prophage - - 306569..322593 16024


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13559.83 Da        Isoelectric Point: 6.7252

>T270546 WP_001549713.1 NZ_CP117329:317006-317374 [Salmonella enterica subsp. enterica serovar Muenster]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGVSLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8196.26 Da        Isoelectric Point: 5.0775

>AT270546 WP_023136533.1 NZ_CP117329:316788-317009 [Salmonella enterica subsp. enterica serovar Muenster]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQMARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5Z7YLS5

Antitoxin

Source ID Structure

References