Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 2038..2573 | Replicon | plasmid pRM106_1 |
Accession | NZ_CP117328 | ||
Organism | Salmonella enterica subsp. enterica serovar Saintpaul strain RM106 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | PQP95_RS22760 | Protein ID | WP_000221869.1 |
Coordinates | 2286..2573 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | PQP95_RS22755 | Protein ID | WP_001132897.1 |
Coordinates | 2038..2289 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP95_RS22750 (46) | 46..1077 | + | 1032 | WP_000907870.1 | plasmid replication initiator RepA | - |
PQP95_RS22755 (2038) | 2038..2289 | + | 252 | WP_001132897.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PQP95_RS22760 (2286) | 2286..2573 | + | 288 | WP_000221869.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PQP95_RS22765 (2879) | 2879..4046 | - | 1168 | Protein_3 | IS91 family transposase | - |
PQP95_RS22770 (4050) | 4050..4241 | - | 192 | WP_228452813.1 | transposase | - |
PQP95_RS22775 (4391) | 4391..4573 | + | 183 | Protein_5 | helix-turn-helix domain-containing protein | - |
PQP95_RS22780 (5605) | 5605..6333 | + | 729 | WP_000497521.1 | hypothetical protein | - |
PQP95_RS22785 (6398) | 6398..6898 | + | 501 | WP_000840063.1 | CS1 type fimbrial major subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / blaTEM-1A | - | 1..114639 | 114639 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11179.35 Da Isoelectric Point: 10.5828
>T270540 WP_000221869.1 NZ_CP117328:2286-2573 [Salmonella enterica subsp. enterica serovar Saintpaul]
MTYMVKFRDDALKEWLKLDKTIQRQFAKKLKKCSDNPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERCNVYNLASERMR
MTYMVKFRDDALKEWLKLDKTIQRQFAKKLKKCSDNPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERCNVYNLASERMR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|