Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4079157..4079673 | Replicon | chromosome |
| Accession | NZ_CP117327 | ||
| Organism | Salmonella enterica subsp. enterica serovar Saintpaul strain RM106 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A7U1KST9 |
| Locus tag | PQP95_RS19645 | Protein ID | WP_000220585.1 |
| Coordinates | 4079157..4079441 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A7U1KSR8 |
| Locus tag | PQP95_RS19650 | Protein ID | WP_000212721.1 |
| Coordinates | 4079431..4079673 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP95_RS19630 (4074273) | 4074273..4075925 | + | 1653 | WP_023137597.1 | alpha,alpha-phosphotrehalase | - |
| PQP95_RS19635 (4076334) | 4076334..4078472 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| PQP95_RS19640 (4078689) | 4078689..4079153 | + | 465 | WP_001009173.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| PQP95_RS19645 (4079157) | 4079157..4079441 | - | 285 | WP_000220585.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PQP95_RS19650 (4079431) | 4079431..4079673 | - | 243 | WP_000212721.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PQP95_RS19655 (4079751) | 4079751..4081664 | - | 1914 | WP_001212126.1 | BglG family transcription antiterminator | - |
| PQP95_RS19660 (4081681) | 4081681..4082421 | - | 741 | WP_000779253.1 | KDGP aldolase family protein | - |
| PQP95_RS19665 (4082418) | 4082418..4083536 | - | 1119 | WP_001139191.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| PQP95_RS19670 (4083520) | 4083520..4084653 | - | 1134 | WP_274891193.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10878.69 Da Isoelectric Point: 9.8739
>T270536 WP_000220585.1 NZ_CP117327:c4079441-4079157 [Salmonella enterica subsp. enterica serovar Saintpaul]
MTYELEIDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEIDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U1KST9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U1KSR8 |