Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 3986531..3987107 | Replicon | chromosome |
Accession | NZ_CP117327 | ||
Organism | Salmonella enterica subsp. enterica serovar Saintpaul strain RM106 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | M7RG88 |
Locus tag | PQP95_RS19250 | Protein ID | WP_001131963.1 |
Coordinates | 3986820..3987107 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | B5R9R5 |
Locus tag | PQP95_RS19245 | Protein ID | WP_000063142.1 |
Coordinates | 3986531..3986833 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP95_RS19230 (3983041) | 3983041..3985191 | + | 2151 | WP_274891180.1 | pyruvate/proton symporter BtsT | - |
PQP95_RS19235 (3985286) | 3985286..3985489 | + | 204 | WP_000460616.1 | YbdD/YjiX family protein | - |
PQP95_RS19240 (3985500) | 3985500..3986456 | + | 957 | WP_000187839.1 | GTPase | - |
PQP95_RS19245 (3986531) | 3986531..3986833 | - | 303 | WP_000063142.1 | BrnA antitoxin family protein | Antitoxin |
PQP95_RS19250 (3986820) | 3986820..3987107 | - | 288 | WP_001131963.1 | BrnT family toxin | Toxin |
PQP95_RS19255 (3987376) | 3987376..3988290 | - | 915 | WP_000290512.1 | restriction endonuclease | - |
PQP95_RS19260 (3988488) | 3988488..3991997 | + | 3510 | WP_274891181.1 | type I restriction-modification system endonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11294.80 Da Isoelectric Point: 9.5894
>T270535 WP_001131963.1 NZ_CP117327:c3987107-3986820 [Salmonella enterica subsp. enterica serovar Saintpaul]
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11373.96 Da Isoelectric Point: 10.1293
>AT270535 WP_000063142.1 NZ_CP117327:c3986833-3986531 [Salmonella enterica subsp. enterica serovar Saintpaul]
MSMVKHKRGNASALSAQHEAELKALAKKSDDEIDYSDIPASEDGQWSEAVRGKFFRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLREQNKK
MSMVKHKRGNASALSAQHEAELKALAKKSDDEIDYSDIPASEDGQWSEAVRGKFFRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLREQNKK
Download Length: 303 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|