Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3381569..3382189 | Replicon | chromosome |
Accession | NZ_CP117327 | ||
Organism | Salmonella enterica subsp. enterica serovar Saintpaul strain RM106 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PQP95_RS16480 | Protein ID | WP_001280991.1 |
Coordinates | 3381971..3382189 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | PQP95_RS16475 | Protein ID | WP_000344807.1 |
Coordinates | 3381569..3381943 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP95_RS16465 (3376708) | 3376708..3377901 | + | 1194 | WP_001039200.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PQP95_RS16470 (3377924) | 3377924..3381073 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
PQP95_RS16475 (3381569) | 3381569..3381943 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
PQP95_RS16480 (3381971) | 3381971..3382189 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PQP95_RS16485 (3382368) | 3382368..3382919 | + | 552 | WP_274891120.1 | maltose O-acetyltransferase | - |
PQP95_RS16490 (3383036) | 3383036..3383506 | + | 471 | WP_000136181.1 | YlaC family protein | - |
PQP95_RS16495 (3383562) | 3383562..3383702 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PQP95_RS16500 (3383708) | 3383708..3383968 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PQP95_RS16505 (3384193) | 3384193..3385743 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
PQP95_RS16515 (3385974) | 3385974..3386363 | + | 390 | WP_000961285.1 | MGMT family protein | - |
PQP95_RS16520 (3386396) | 3386396..3386965 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T270532 WP_001280991.1 NZ_CP117327:3381971-3382189 [Salmonella enterica subsp. enterica serovar Saintpaul]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT270532 WP_000344807.1 NZ_CP117327:3381569-3381943 [Salmonella enterica subsp. enterica serovar Saintpaul]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|