Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 847857..848482 | Replicon | chromosome |
| Accession | NZ_CP117327 | ||
| Organism | Salmonella enterica subsp. enterica serovar Saintpaul strain RM106 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A5U3PLM7 |
| Locus tag | PQP95_RS04105 | Protein ID | WP_023137617.1 |
| Coordinates | 848084..848482 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | M7S3S8 |
| Locus tag | PQP95_RS04100 | Protein ID | WP_000557549.1 |
| Coordinates | 847857..848084 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP95_RS04070 (842901) | 842901..844418 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
| PQP95_RS04075 (844494) | 844494..845039 | - | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
| PQP95_RS04080 (845304) | 845304..846062 | + | 759 | WP_000244329.1 | amidase activator ActS | - |
| PQP95_RS04090 (846347) | 846347..847153 | - | 807 | WP_010989071.1 | DUF1460 domain-containing protein | - |
| PQP95_RS04095 (847428) | 847428..847680 | - | 253 | Protein_801 | hypothetical protein | - |
| PQP95_RS04100 (847857) | 847857..848084 | + | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| PQP95_RS04105 (848084) | 848084..848482 | + | 399 | WP_023137617.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| PQP95_RS04110 (849290) | 849290..849826 | + | 537 | WP_001038502.1 | STM3031 family outer membrane protein | - |
| PQP95_RS04115 (849873) | 849873..850505 | + | 633 | WP_000835265.1 | YfdX family protein | - |
| PQP95_RS04120 (851224) | 851224..851808 | + | 585 | WP_001244638.1 | fimbrial protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 846347..856268 | 9921 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15009.37 Da Isoelectric Point: 7.2155
>T270525 WP_023137617.1 NZ_CP117327:848084-848482 [Salmonella enterica subsp. enterica serovar Saintpaul]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSQMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSQMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5U3PLM7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6IFM | |
| AlphaFold DB | A0A3V2Y5V5 |