Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 836969..837629 | Replicon | chromosome |
Accession | NZ_CP117327 | ||
Organism | Salmonella enterica subsp. enterica serovar Saintpaul strain RM106 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | Q57K70 |
Locus tag | PQP95_RS04040 | Protein ID | WP_000244756.1 |
Coordinates | 837216..837629 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S5MU13 |
Locus tag | PQP95_RS04035 | Protein ID | WP_000351186.1 |
Coordinates | 836969..837235 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP95_RS04015 (832897) | 832897..834330 | - | 1434 | WP_001230141.1 | 6-phospho-beta-glucosidase BglA | - |
PQP95_RS04020 (834489) | 834489..834800 | + | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
PQP95_RS04025 (834964) | 834964..835623 | + | 660 | WP_000250289.1 | hemolysin III family protein | - |
PQP95_RS04030 (835739) | 835739..836719 | - | 981 | WP_000874172.1 | tRNA-modifying protein YgfZ | - |
PQP95_RS04035 (836969) | 836969..837235 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
PQP95_RS04040 (837216) | 837216..837629 | + | 414 | WP_000244756.1 | protein YgfX | Toxin |
PQP95_RS04045 (837682) | 837682..838203 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
PQP95_RS04050 (838316) | 838316..839212 | + | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
PQP95_RS04055 (839236) | 839236..839949 | + | 714 | WP_000745625.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PQP95_RS04060 (839955) | 839955..841688 | + | 1734 | WP_023137618.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16183.15 Da Isoelectric Point: 10.7537
>T270524 WP_000244756.1 NZ_CP117327:837216-837629 [Salmonella enterica subsp. enterica serovar Saintpaul]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Download Length: 89 a.a. Molecular weight: 10550.05 Da Isoelectric Point: 6.0783
>AT270524 WP_000351186.1 NZ_CP117327:836969-837235 [Salmonella enterica subsp. enterica serovar Saintpaul]
MDIHNKARIHWACRRGMRELDISIMPFFEHEYDSLSDEEKRIFVRLLQSDDPDLFNWLMNHGKPADAELEQMVRLIQTRN
RERGPVAI
MDIHNKARIHWACRRGMRELDISIMPFFEHEYDSLSDEEKRIFVRLLQSDDPDLFNWLMNHGKPADAELEQMVRLIQTRN
RERGPVAI
Download Length: 267 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E9V5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0YWH4 |