Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4263198..4263979 | Replicon | chromosome |
Accession | NZ_CP117326 | ||
Organism | Salmonella enterica subsp. enterica serovar Newport strain RM108 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A0R9NZI3 |
Locus tag | PQQ05_RS20805 | Protein ID | WP_000625912.1 |
Coordinates | 4263198..4263689 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | M7RNV8 |
Locus tag | PQQ05_RS20810 | Protein ID | WP_001110450.1 |
Coordinates | 4263686..4263979 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ05_RS20780 (4260080) | 4260080..4260910 | - | 831 | WP_001180236.1 | fimbria/pilus periplasmic chaperone | - |
PQQ05_RS20785 (4261112) | 4261112..4261417 | - | 306 | WP_000370555.1 | PapB/FocB family fimbrial expression transcriptional regulator | - |
PQQ05_RS20790 (4261948) | 4261948..4262091 | + | 144 | Protein_4064 | transposase | - |
PQQ05_RS20795 (4262108) | 4262108..4262454 | + | 347 | Protein_4065 | Rpn family recombination-promoting nuclease/putative transposase | - |
PQQ05_RS20800 (4262735) | 4262735..4262983 | - | 249 | Protein_4066 | IS481 family transposase | - |
PQQ05_RS20805 (4263198) | 4263198..4263689 | - | 492 | WP_000625912.1 | GNAT family N-acetyltransferase | Toxin |
PQQ05_RS20810 (4263686) | 4263686..4263979 | - | 294 | WP_001110450.1 | DUF1778 domain-containing protein | Antitoxin |
PQQ05_RS20815 (4264296) | 4264296..4264518 | + | 223 | Protein_4069 | hypothetical protein | - |
PQQ05_RS20820 (4264782) | 4264782..4265657 | + | 876 | WP_000921676.1 | AraC family transcriptional regulator | - |
PQQ05_RS20825 (4265654) | 4265654..4265941 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
PQQ05_RS20830 (4265934) | 4265934..4266116 | - | 183 | WP_001670702.1 | ATP-binding cassette domain-containing protein | - |
PQQ05_RS20835 (4266136) | 4266136..4266235 | + | 100 | Protein_4073 | hypothetical protein | - |
PQQ05_RS20840 (4266233) | 4266233..4266484 | + | 252 | Protein_4074 | hypothetical protein | - |
PQQ05_RS20845 (4266779) | 4266779..4267684 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4256286..4266388 | 10102 | |
- | inside | Genomic island | - | - | 4252592..4266388 | 13796 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17606.43 Da Isoelectric Point: 7.7297
>T270518 WP_000625912.1 NZ_CP117326:c4263689-4263198 [Salmonella enterica subsp. enterica serovar Newport]
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSSVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSSVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10949.56 Da Isoelectric Point: 8.6141
>AT270518 WP_001110450.1 NZ_CP117326:c4263979-4263686 [Salmonella enterica subsp. enterica serovar Newport]
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R9NZI3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R9PGG6 |