Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3421075..3421695 | Replicon | chromosome |
| Accession | NZ_CP117326 | ||
| Organism | Salmonella enterica subsp. enterica serovar Newport strain RM108 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | PQQ05_RS16770 | Protein ID | WP_001280991.1 |
| Coordinates | 3421477..3421695 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | PQQ05_RS16765 | Protein ID | WP_000344807.1 |
| Coordinates | 3421075..3421449 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ05_RS16755 (3416214) | 3416214..3417407 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PQQ05_RS16760 (3417430) | 3417430..3420579 | + | 3150 | WP_274890115.1 | efflux RND transporter permease AcrB | - |
| PQQ05_RS16765 (3421075) | 3421075..3421449 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| PQQ05_RS16770 (3421477) | 3421477..3421695 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| PQQ05_RS16775 (3421874) | 3421874..3422425 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
| PQQ05_RS16780 (3422542) | 3422542..3423012 | + | 471 | WP_000136181.1 | YlaC family protein | - |
| PQQ05_RS16785 (3423068) | 3423068..3423208 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| PQQ05_RS16790 (3423214) | 3423214..3423474 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| PQQ05_RS16795 (3423699) | 3423699..3425249 | + | 1551 | WP_000213138.1 | EAL domain-containing protein | - |
| PQQ05_RS16805 (3425480) | 3425480..3425868 | + | 389 | Protein_3284 | MGMT family protein | - |
| PQQ05_RS16810 (3425901) | 3425901..3426470 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T270514 WP_001280991.1 NZ_CP117326:3421477-3421695 [Salmonella enterica subsp. enterica serovar Newport]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT270514 WP_000344807.1 NZ_CP117326:3421075-3421449 [Salmonella enterica subsp. enterica serovar Newport]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|