Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 847202..847827 | Replicon | chromosome |
Accession | NZ_CP117326 | ||
Organism | Salmonella enterica subsp. enterica serovar Newport strain RM108 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PQQ05_RS04105 | Protein ID | WP_000911337.1 |
Coordinates | 847429..847827 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | C0PXM4 |
Locus tag | PQQ05_RS04100 | Protein ID | WP_000557545.1 |
Coordinates | 847202..847429 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ05_RS04070 (842247) | 842247..843764 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
PQQ05_RS04075 (843840) | 843840..844385 | - | 546 | WP_000133986.1 | isopentenyl-diphosphate Delta-isomerase | - |
PQQ05_RS04080 (844650) | 844650..845408 | + | 759 | WP_000244328.1 | amidase activator ActS | - |
PQQ05_RS04090 (845693) | 845693..846499 | - | 807 | WP_010989071.1 | DUF1460 domain-containing protein | - |
PQQ05_RS04095 (846774) | 846774..847025 | - | 252 | WP_001540858.1 | hypothetical protein | - |
PQQ05_RS04100 (847202) | 847202..847429 | + | 228 | WP_000557545.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
PQQ05_RS04105 (847429) | 847429..847827 | + | 399 | WP_000911337.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
PQQ05_RS04110 (848635) | 848635..849171 | + | 537 | WP_001038502.1 | STM3031 family outer membrane protein | - |
PQQ05_RS04115 (849218) | 849218..849850 | + | 633 | WP_000835265.1 | YfdX family protein | - |
PQQ05_RS04120 (850569) | 850569..851150 | + | 582 | WP_001244652.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 846774..855609 | 8835 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15037.43 Da Isoelectric Point: 7.7785
>T270508 WP_000911337.1 NZ_CP117326:847429-847827 [Salmonella enterica subsp. enterica serovar Newport]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|