Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 4083955..4084505 | Replicon | chromosome |
| Accession | NZ_CP117322 | ||
| Organism | Salmonella enterica subsp. enterica serovar Derby strain RM001 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | M7RJ32 |
| Locus tag | PQP82_RS19740 | Protein ID | WP_001199743.1 |
| Coordinates | 4083955..4084263 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | V7ITQ8 |
| Locus tag | PQP82_RS19745 | Protein ID | WP_000016244.1 |
| Coordinates | 4084266..4084505 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP82_RS19725 (4081979) | 4081979..4082758 | - | 780 | WP_023232244.1 | HNH endonuclease | - |
| PQP82_RS19730 (4082919) | 4082919..4083233 | + | 315 | WP_023232245.1 | hypothetical protein | - |
| PQP82_RS19735 (4083213) | 4083213..4083520 | - | 308 | Protein_3861 | Arm DNA-binding domain-containing protein | - |
| PQP82_RS19740 (4083955) | 4083955..4084263 | - | 309 | WP_001199743.1 | CcdB family protein | Toxin |
| PQP82_RS19745 (4084266) | 4084266..4084505 | - | 240 | WP_000016244.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| PQP82_RS19750 (4084618) | 4084618..4084866 | - | 249 | WP_000168385.1 | ribbon-helix-helix domain-containing protein | - |
| PQP82_RS19755 (4084943) | 4084943..4085251 | - | 309 | Protein_3865 | DUF4942 domain-containing protein | - |
| PQP82_RS19760 (4085271) | 4085271..4086248 | - | 978 | WP_223156438.1 | IS630 family transposase | - |
| PQP82_RS19770 (4087006) | 4087006..4088025 | + | 1020 | WP_000152563.1 | NAD(P)-dependent alcohol dehydrogenase | - |
| PQP82_RS19775 (4088053) | 4088053..4088583 | - | 531 | WP_023232248.1 | gluconokinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 4085271..4086203 | 932 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11845.67 Da Isoelectric Point: 6.7228
>T270501 WP_001199743.1 NZ_CP117322:c4084263-4083955 [Salmonella enterica subsp. enterica serovar Derby]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C6Z9V9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I5T4R8 |