Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3393004..3393624 | Replicon | chromosome |
| Accession | NZ_CP117322 | ||
| Organism | Salmonella enterica subsp. enterica serovar Derby strain RM001 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | PQP82_RS16450 | Protein ID | WP_001280991.1 |
| Coordinates | 3393406..3393624 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A4Q7HJ94 |
| Locus tag | PQP82_RS16445 | Protein ID | WP_023231707.1 |
| Coordinates | 3393004..3393378 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP82_RS16435 (3388143) | 3388143..3389336 | + | 1194 | WP_023231706.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PQP82_RS16440 (3389359) | 3389359..3392508 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| PQP82_RS16445 (3393004) | 3393004..3393378 | + | 375 | WP_023231707.1 | Hha toxicity modulator TomB | Antitoxin |
| PQP82_RS16450 (3393406) | 3393406..3393624 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| PQP82_RS16455 (3393803) | 3393803..3394354 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
| PQP82_RS16460 (3394472) | 3394472..3394942 | + | 471 | WP_000136183.1 | YlaC family protein | - |
| PQP82_RS16465 (3394998) | 3394998..3395138 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| PQP82_RS16470 (3395144) | 3395144..3395404 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| PQP82_RS16475 (3395629) | 3395629..3397179 | + | 1551 | WP_023231708.1 | EAL domain-containing protein | - |
| PQP82_RS16485 (3397410) | 3397410..3397799 | + | 390 | WP_000961285.1 | MGMT family protein | - |
| PQP82_RS16490 (3397832) | 3397832..3398401 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T270498 WP_001280991.1 NZ_CP117322:3393406-3393624 [Salmonella enterica subsp. enterica serovar Derby]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14439.24 Da Isoelectric Point: 5.1444
>AT270498 WP_023231707.1 NZ_CP117322:3393004-3393378 [Salmonella enterica subsp. enterica serovar Derby]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLVAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLVAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|