Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2324901..2325423 | Replicon | chromosome |
Accession | NZ_CP117322 | ||
Organism | Salmonella enterica subsp. enterica serovar Derby strain RM001 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | PQP82_RS11270 | Protein ID | WP_000221343.1 |
Coordinates | 2324901..2325185 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | PQP82_RS11275 | Protein ID | WP_000885424.1 |
Coordinates | 2325175..2325423 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP82_RS11250 (2320976) | 2320976..2322484 | - | 1509 | WP_048348841.1 | FAD-dependent oxidoreductase | - |
PQP82_RS11255 (2322529) | 2322529..2323017 | + | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
PQP82_RS11260 (2323210) | 2323210..2324289 | + | 1080 | WP_023231841.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
PQP82_RS11265 (2324341) | 2324341..2324730 | - | 390 | WP_023206403.1 | RidA family protein | - |
PQP82_RS11270 (2324901) | 2324901..2325185 | - | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PQP82_RS11275 (2325175) | 2325175..2325423 | - | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PQP82_RS11280 (2326098) | 2326098..2326520 | + | 423 | WP_048348840.1 | PTS sugar transporter subunit IIA | - |
PQP82_RS11285 (2326580) | 2326580..2326861 | + | 282 | WP_023218025.1 | PTS sugar transporter subunit IIB | - |
PQP82_RS11290 (2326873) | 2326873..2328264 | + | 1392 | WP_023218026.1 | PTS galactitol transporter subunit IIC | - |
PQP82_RS11295 (2328342) | 2328342..2329853 | + | 1512 | WP_023231843.1 | FGGY family carbohydrate kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2323210..2340323 | 17113 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T270493 WP_000221343.1 NZ_CP117322:c2325185-2324901 [Salmonella enterica subsp. enterica serovar Derby]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |