Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 4107003..4107646 | Replicon | chromosome |
Accession | NZ_CP117317 | ||
Organism | Salmonella enterica subsp. enterica serovar Derby strain RM002 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B5F3H8 |
Locus tag | PQQ14_RS19840 | Protein ID | WP_000048134.1 |
Coordinates | 4107230..4107646 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B5F3H9 |
Locus tag | PQQ14_RS19835 | Protein ID | WP_001261294.1 |
Coordinates | 4107003..4107233 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ14_RS19820 (4102052) | 4102052..4103704 | + | 1653 | WP_023232256.1 | alpha,alpha-phosphotrehalase | - |
PQQ14_RS19825 (4104113) | 4104113..4106251 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
PQQ14_RS19830 (4106372) | 4106372..4106836 | + | 465 | WP_023232257.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
PQQ14_RS19835 (4107003) | 4107003..4107233 | + | 231 | WP_001261294.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PQQ14_RS19840 (4107230) | 4107230..4107646 | + | 417 | WP_000048134.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PQQ14_RS19845 (4107707) | 4107707..4109620 | - | 1914 | WP_274881225.1 | BglG family transcription antiterminator | - |
PQQ14_RS19850 (4109637) | 4109637..4110377 | - | 741 | WP_023229489.1 | KDGP aldolase family protein | - |
PQQ14_RS19855 (4110374) | 4110374..4111492 | - | 1119 | WP_023232259.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
PQQ14_RS19860 (4111476) | 4111476..4112609 | - | 1134 | WP_274881227.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15135.50 Da Isoelectric Point: 8.1381
>T270481 WP_000048134.1 NZ_CP117317:4107230-4107646 [Salmonella enterica subsp. enterica serovar Derby]
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAAGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAAGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2T8L749 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V4SIC2 |