Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3374037..3374657 | Replicon | chromosome |
Accession | NZ_CP117317 | ||
Organism | Salmonella enterica subsp. enterica serovar Derby strain RM002 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PQQ14_RS16330 | Protein ID | WP_001280991.1 |
Coordinates | 3374439..3374657 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A4Q7HJ94 |
Locus tag | PQQ14_RS16325 | Protein ID | WP_023231707.1 |
Coordinates | 3374037..3374411 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ14_RS16315 (3369176) | 3369176..3370369 | + | 1194 | WP_023231706.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PQQ14_RS16320 (3370392) | 3370392..3373541 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
PQQ14_RS16325 (3374037) | 3374037..3374411 | + | 375 | WP_023231707.1 | Hha toxicity modulator TomB | Antitoxin |
PQQ14_RS16330 (3374439) | 3374439..3374657 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PQQ14_RS16335 (3374836) | 3374836..3375378 | + | 543 | WP_274881080.1 | maltose O-acetyltransferase | - |
PQQ14_RS16340 (3375505) | 3375505..3375975 | + | 471 | WP_000136183.1 | YlaC family protein | - |
PQQ14_RS16345 (3376031) | 3376031..3376171 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PQQ14_RS16350 (3376177) | 3376177..3376437 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PQQ14_RS16355 (3376662) | 3376662..3378212 | + | 1551 | WP_023231708.1 | EAL domain-containing protein | - |
PQQ14_RS16365 (3378443) | 3378443..3378832 | + | 390 | WP_000961285.1 | MGMT family protein | - |
PQQ14_RS16370 (3378865) | 3378865..3379434 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T270477 WP_001280991.1 NZ_CP117317:3374439-3374657 [Salmonella enterica subsp. enterica serovar Derby]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14439.24 Da Isoelectric Point: 5.1444
>AT270477 WP_023231707.1 NZ_CP117317:3374037-3374411 [Salmonella enterica subsp. enterica serovar Derby]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLVAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLVAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|